Bugs fixed during the Xenial release cycle

This is a report of bug tasks from Launchpad-Bugs-Fixed in the Xenial changes mailing list. All of the columns are sortable; give them a click! However, it might take a bit as the table is quite long.

SummaryInFixerDate CreatedDate FixedDays to Fix
1158510libmtp fails to open after upgrade to 12.10libmtpseb128@ubuntu.com2013-03-212015-10-26949
1509356pep8 depends on python3-pep, not python3-pep8pep8doko@ubuntu.com2015-10-232015-10-252
1509396Missing dependency on python-setuptoolspython-flake8doko@ubuntu.com2015-10-232015-10-252
1504481package xe-guest-utilities 6.2.0-1120+dsf1-0ubuntu1~14.04.1 failed to install: sub-processo script post-installation instalado retornou estado de saída de erro 1xe-guest-utilitiesben.howard@ubuntu.com2015-10-092015-10-2314
1418771gjs-console assert failure: *** Error in `/usr/bin/gjs-console': free(): invalid next size (fast): 0x00007f74a804b240 ***trackertim@feathertop.org2015-10-232015-11-1321
1508289xtrs: FTBFS with GCC 5: trs_memory.c:152:6: error: type of 'state' defaults to 'int' [-Werror=implicit-int]xtrslogan@ubuntu.com2015-10-212015-10-276
1237904Xorg crashed with SIGABRT in OsAbort()xorg-servertim@feathertop.org2013-10-102015-10-26746
1432683apt-get install lxc doesn't load required apparmor profilesupstartmartin.pitt@ubuntu.com2015-03-272015-10-26213
1508466empty monitor, serial, parallel with -curses with TERM=xterm-256colorqemuryan.harper@canonical.com2015-10-212015-10-265
1506823Shell Command Injection with a picturepitividaniel.holbach@ubuntu.com2015-10-162015-10-2711
1500591ubuntu-drivers-common should not care about case-sensitivity in modaliasesubuntu-drivers-commonmartin.pitt@ubuntu.com2015-09-282015-10-2628
1422143No wifi connection after suspend with systemd due to missing "wpa_cli suspend"wpamartin.pitt@ubuntu.com2015-02-152015-10-27254
1510095live-build doesn't know the correct name for ppc64el kernels in /bootlive-buildcjwatson@ubuntu.com2015-10-262015-10-260
1493888FGLRX incompatible with gcc 5fglrx-installeralberto.milone@canonical.com2015-09-092015-10-2647
1506169if linux metapackage is installed software properties will uninstall itsoftware-propertiesbrian@ubuntu.com2015-10-142015-10-2713
1510067qtmir rebuild fails with "assertion fail ../../bfd/elf32-i386.c:5245"binutilsdoko@ubuntu.com2015-10-262015-10-271
1508054[desktop] Crashes on startupapparmor-easyprof-ubuntujamie@ubuntu.com2015-10-202015-10-277
1509334[sru] plasma-nm blocks temporarily on startup w/o bluetooth device – KDE/Plasma very slow to launch (Kubuntu 15.10)plasma-nmclivejo@aol.com2015-10-232015-10-263
1510270fwupdate build fails on i386 with assertion fail ../../bfd/elf32-i386.c:5245binutilsdoko@ubuntu.com2015-10-262015-10-271
1496548evince no longer built with -PIEevinceseb128@ubuntu.com2015-09-162015-10-2741
1506967display page labels in find sidebarevinceseb128@ubuntu.com2015-10-162015-10-2711
1471862ubuntu-core-launcher apparmor denialubuntu-core-launcherjamie@ubuntu.com2015-10-272015-10-270
1507480Privilege escalation through Python module importsapportmartin.pitt@ubuntu.com2015-10-192015-10-289
1510318Augeas 1.3 can't read some conf filesaugeasrobie.basak@ubuntu.com2015-10-262015-10-271
1510573fglrx should blacklist amdgpufglrx-installeralberto.milone@canonical.com2015-10-272015-10-270
1510558ppa shortcut handler exception stops shortcut resolutionsoftware-propertiesbrian@ubuntu.com2015-10-272015-10-270
1467267Please sync from Debian (main)network-manager-appletrobert.ancell@canonical.com2015-06-262016-01-22210
1485093python3-distupgrade contains symlink to externally owned directoryubuntu-release-upgraderbrian@ubuntu.com2015-08-142015-10-2774
1509305new kernel removed after upgrade if linux meta package not installedubuntu-release-upgraderbrian@ubuntu.com2015-10-232015-10-274
1442609Guest session needs read access to "/proc/net/dev" and/or "/proc/*/net/dev" for network traffic applicationslightdmrobert.ancell@canonical.com2015-04-132015-10-28198
1442611Guest session can't write on /var/run/screenlightdmrobert.ancell@canonical.com2015-04-132015-10-28198
1464958chromium-browser does not run in guest accountlightdmrobert.ancell@canonical.com2015-10-122015-10-2816
1509005[regression] mir-client-platform-mesa-dev pkg-config file droppedmesatjaalton@debian.org2015-10-262015-11-027
1450960dev file system is mounted without nosuidsystemdmartin.pitt@ubuntu.com2015-05-022015-10-28179
1492546ifdown stops LTSP's "manual" interface on shutdownsystemdmartin.pitt@ubuntu.com2015-09-052016-01-13130
1510743Update to 3.18.0adwaita-icon-themetim@feathertop.org2015-10-282015-10-280
1510813Update to 3.18.1gnome-desktop3noskcaj@ubuntu.com2015-10-282015-11-0710
1509896IPMI USB SCSI endpoint discovery can fail on OpenPower machinesipmitoolmathieu-tl@ubuntu.com2015-10-262015-10-293
1487148[MIR] fonts-stix -- to replace xfonts-mathmllibreoffice-l10nbjoern.michaelsen@canonical.com2016-02-162016-02-226
1506544Change default Theme for LibreOffice to Breeze for Ubuntu 16.04libreoffice-l10nbjoern.michaelsen@canonical.com2015-10-152016-03-14151
1508177[SRU] Starting LibreOffice with an empty profile from the ISO creates a profile selecting galaxy, not human as themelibreoffice-l10nbjoern.michaelsen@canonical.com2015-10-202015-11-1324
1509489[SRU] seccomp filters backport for Makolinux-makotim.gardner@canonical.com2015-10-232015-10-285
1510686Update to 3.18epiphany-browserrobert.ancell@canonical.com2015-10-272015-10-292
1194342Update to 1.58popularity-contestseb128@ubuntu.com2013-06-252015-10-29856
1510819Xenial: evince (3.18.1-1ubuntu1) depends on gnome-icon-theme-symbolic while gnome-shell (3.18.1-1ububtu1) depends on adwaita-icon-themeevinceseb128@ubuntu.com2015-10-282015-10-291
1473680Please update Ninja from Debianninja-buildubuntu@desserud.org2015-07-112015-10-29110
1508075ubiquity and others time out on polkit (killed by udisks2-inhibit)udisks2martin.pitt@ubuntu.com2015-10-202015-10-299
1510565[needs-packaging] Juju 1.25.0 is not in xenial and wilyjuju-corecurtis.hovey@canonical.com2015-10-272015-10-303
1481122plugin methods return Truesnapcraftsergio.schvezov@canonical.com2015-08-042015-11-0492
1499424snapcraft throws FileExistsError: with very simple Python snapsnapcraftsergio.schvezov@canonical.com2015-09-242015-11-0441
1501222Snapcraft should respond to "help", "version", "-v", "--version"snapcraftsergio.schvezov@canonical.com2015-09-302015-11-0435
1502031maven plugin - support for maven commandssnapcraftsergio.schvezov@canonical.com2015-10-022015-11-0433
1506096Tests are not run when doing dpkg-buildpackagesnapcraftsergio.schvezov@canonical.com2015-10-142015-11-0421
1506201Add support for building ros/catkin based projectssnapcraftsergio.schvezov@canonical.com2015-10-142015-11-0421
1506205Support wiki searches when type is missingsnapcraftsergio.schvezov@canonical.com2015-10-142015-11-0421
1507075Document the plugin base classsnapcraftsergio.schvezov@canonical.com2015-10-172015-11-0418
1507573AttributeError: 'module' object has no attribute 'tests'snapcraftsergio.schvezov@canonical.com2015-10-192015-11-0416
1507648Autotools doesn't work without autogen.shsnapcraftsergio.schvezov@canonical.com2015-10-192015-11-0416
1507814Installing build-packages fails for removed but not purged depssnapcraftsergio.schvezov@canonical.com2015-10-192015-11-0416
1510160list-plugins commandsnapcraftsergio.schvezov@canonical.com2015-10-262015-11-049
1510683Add help subcommandsnapcraftsergio.schvezov@canonical.com2015-10-272015-11-048
1510954Help crashes if specified plugin does not existsnapcraftsergio.schvezov@canonical.com2015-10-282015-11-047
1511161java-hello-world example fails to snap on vivid: Operation not permitted: '/home/elopio/workspace/canonical/snapcraft/trunk/examples/java-hello-world/parts/local/install/sbin/mount.ntfs'snapcraftsergio.schvezov@canonical.com2015-10-292015-11-046
1498655Steam Controller support: need read-write access to Valve-owned input event device nodes.steammarc.deslauriers@ubuntu.com2015-09-222015-10-2937
1484027systemd-tmpfiles-clean warns about duplicate /var/log linersyslogmartin.pitt@ubuntu.com2015-08-122015-10-2978
1493335Support for 'list members of group(s) only'unity-greeterrobert.ancell@canonical.com2015-09-082015-10-3052
1508357Tooltips have a black squares outside of its rounded cornersgtk+3.0marco@ubuntu.com2015-10-212015-10-309
1511047packages FTBFS if gir libraries don't contain a GObjectgobject-introspectionstephen.webb@canonical.com2015-10-282015-10-313
1511523Revert to evince, evince-gtk is going awayxubuntu-metasmd.seandavis@gmail.com2015-10-292015-11-013
1511376install writes /etc/mtab as file, not symlinkubiquitymartin.pitt@ubuntu.com2015-10-292015-10-290
1283426nautilus crashed with SIGSEGV in build_file_list_from_uris()gtk+3.0seb128@ubuntu.com2014-02-222015-11-03619
1512290gnome-screenshot produces very low quality blurry screenshotsgtk+3.0seb128@ubuntu.com2015-11-022016-03-12131
1480217Nautilus background handling screwed when changing scaling factor.nautiluslars.uebernickel@ubuntu.com2015-07-312015-11-0799
1507244Missing erasure coding plugins for jerasure/neon and sheccephjames.page@ubuntu.com2015-10-182015-11-0215
1512292[SRU] update to 0.94.5cephjames.page@ubuntu.com2015-11-022015-11-020
1511830apparmor denies VM startup when image is network mountedlibvirtserge.hallyn@ubuntu.com2015-10-302015-11-023
1511259Session child does not inherit all LC_* variableslightdmrobert.ancell@canonical.com2015-11-032015-11-030
1511545Implement XDMCP ForwardQuerylightdmrobert.ancell@canonical.com2015-11-032015-11-030
1511831dist upgrade quirk for linux metapackage crashes if package is not in cacheubuntu-release-upgraderbrian@ubuntu.com2015-10-302015-11-034
1512241USN-2781-1: MySQL vulnerabilities partially also applies to MariaDBmariadb-10.0otto@seravo.fi2015-11-022015-11-042
1512190matplotlib 1.5.0~rc2-1ubuntu2: autopkgtest failures on all architectures, SIGBUS in python2.7-dbgmatplotlibiain@orangesquash.org.uk2015-11-022015-11-042
1512749lxcbr0 dissappears on Ubuntu 15.10lxcstgraber@ubuntu.com2015-11-032015-11-041
1382233whoopsie does not upload UnreportableReason field in crash reportswhoopsiebrian@ubuntu.com2014-10-162015-11-03383
1512902apport will create .upload files for incomplete or corrupt crash reportsapportbrian@ubuntu.com2015-11-032015-11-041
1440388please port ubuntu-system-service to Python3ubuntu-system-servicemartin.pitt@ubuntu.com2015-04-042015-11-04214
1503305iLab: power kvm client after svc node reboot error inject test, multipath output show missing path and missing storage namemultipath-toolsmathieu-tl@ubuntu.com2015-10-062015-11-0429
1511949Please merge gyp from Debiangypubuntu@desserud.org2015-10-312015-11-044
1071746Missing information in proc(5)manpagesseb128@ubuntu.com2012-10-262015-11-041104
1110781resolv.conf(5) fails to mention some optionsmanpagesseb128@ubuntu.com2013-01-302015-11-041008
1397652/dev/random and /dev/urandom world writeablemanpagesseb128@ubuntu.com2014-11-302015-11-04339
1513110global menus are broken and cannot be clickedindicator-appmenuiain@orangesquash.org.uk2015-11-042015-11-040
1492429please update open-vm-tools to version 10.0.0open-vm-toolsrobert.jennings@ubuntu.com2015-09-042015-11-0461
118522Word wrap is too commonly changed to be in preferences, should be a menugeditseb128@ubuntu.com2007-06-032015-11-103082
234711print preview popup fails to disappeargeditseb128@ubuntu.com2008-05-252015-11-102725
301942Gedit ctrl-T does not open new tabgeditseb128@ubuntu.com2008-11-252015-11-102541
331077gedit : margins on printed documents are too smallgeditseb128@ubuntu.com2009-02-182015-11-102456
413360Pango text select with double click stops at underscore.geditseb128@ubuntu.com2009-08-142015-11-102279
575500refuses to open files with incorrect encodinggeditseb128@ubuntu.com2010-05-052015-11-102015
589906Auto-save when gedit loses focus fails, generating critical errorsgeditseb128@ubuntu.com2010-06-042015-11-101985
615506Underscore must be a part of the wordgeditseb128@ubuntu.com2010-08-092015-11-101919
848253Gedit won't let me edit binary files to look for textgeditseb128@ubuntu.com2011-09-122015-11-101520
867923gedit refuses to save file when backup cannot be created.geditseb128@ubuntu.com2011-10-042015-11-101498
928420gedit SIGSEGV in scroll_to_cursor() in file openinggeditseb128@ubuntu.com2012-02-072015-11-101372
929554"There was a problem opening.." window doesn't appear after Print Previewgeditseb128@ubuntu.com2012-02-092015-11-101370
1302451Minimap "Goto Anything" panelgeditseb128@ubuntu.com2014-04-042015-11-10585
1335613Bad interaction between "code snippets" and "autocompletion plugin" in geditgeditseb128@ubuntu.com2014-06-292015-11-10499
1339371Update to 3.16geditseb128@ubuntu.com2014-07-082015-11-10490
1504168fix handling of mx4 touch screenlibinputtjaalton@debian.org2015-10-082015-11-0528
1274726Rhythmbox "Control" menu states that Control-Space controls play/pause, but actually Control-P is the shortcutrhythmboxseb128@ubuntu.com2014-01-302015-11-05644
1513251Sync preferences not visible in device properties windowrhythmboxseb128@ubuntu.com2015-11-042015-11-051
1177432[SRU] cloud-init archive template should match Ubuntu Servercloud-initsmoser@ubuntu.com2013-05-072015-11-05912
1505576internal error: Failed to initialize a valid firewall backendlibvirtmarc.deslauriers@ubuntu.com2015-10-132015-11-0624
1513757Fails to run properly: TypeError: QPen(): argument 1 has unexpected type 'QBrush'frescobalditjaalton@debian.org2015-11-062015-11-060
1513754Move cloud image building further on to builddslivecd-rootfsdaniel.watkins@canonical.com2015-11-062015-11-060
1496860system-config-printer split seems to be brokensystem-config-printertill.kamppeter@gmail.com2015-09-172015-11-0650
1513424debian/rules refers to old binary package namesystem-config-printertill.kamppeter@gmail.com2015-11-052015-11-061
1512435Stop depending on gnome-control-centerpolicykit-desktop-privilegesseb128@ubuntu.com2015-11-182015-11-180
1511542 [2.26 Regression] binutils assertion fail ../../bfd/elfnn-aarch64.c:4631binutilsdoko@ubuntu.com2015-10-292015-11-079
1513207[SRU] Enable squashfs supportlinux-makotim.gardner@canonical.com2015-11-042015-11-062
1513463[SRU] Kernel too big for boot partitionlinux-makotim.gardner@canonical.com2015-11-052015-11-061
1512915Update to 3.18gnome-settings-daemontim@feathertop.org2015-11-042015-11-084
1511140Update to 3.18.1gnome-control-centertim@feathertop.org2015-10-282015-11-0710
1477198Stop doesn't work on 14.04 (start-stop-daemon --pid not supported)haproxyjames.page@ubuntu.com2015-07-222015-11-09110
1481737HAProxy init script does not work correctly with nbproc configuration optionhaproxyjames.page@ubuntu.com2015-08-052015-11-0996
1513293unzip security update leads to extracting errorsunzipmarc.deslauriers@ubuntu.com2015-11-052015-11-116
1514485[SRU] cloud-init should use "nofail" instead of "bootwait"walinuxagentben.howard@ubuntu.com2015-11-092015-11-101
1466458template 'none' doesn't work with lxc-createlxcstgraber@ubuntu.com2015-06-182015-11-09144
1510619Wily: add machine fails using kvm and lxcbr0lxcstgraber@ubuntu.com2015-10-272015-11-0913
1514558New upstream bugfix release 1.1.5 (LXC MRE)lxcstgraber@ubuntu.com2015-11-092015-11-090
1450147'im-config -l' complains about zenity not installedim-configgunnarhj@ubuntu.com2015-04-292015-11-10195
1512136Please merge xscreensaver 5.34-1(universe) from Debian (main)xscreensaverunit193@ubuntu.com2015-11-012015-11-109
1337873ifupdown initialization problems caused by race conditionifupdowndariusz.gadomski@canonical.com2016-01-052016-01-050
1511649please merge xorg-server from debianxorg-servertjaalton@debian.org2015-10-302015-11-1112
1385868Samba logrotate script uses invalid argument to /etc/init.d/nmdbsambaseb128@ubuntu.com2014-10-262015-11-11381
1491729dkms: add module build ordering for ZFS on Linuxdkmscolin.king@canonical.com2015-09-032015-11-1169
1515019FTBFS against ocaml 4.02beniain@orangesquash.org.uk2015-11-102015-11-133
1512914Update to 3.18gnome-sessiontim@feathertop.org2015-11-042015-11-128
1515358Please merge xmlgraphics-commons from Debianxmlgraphics-commonsubuntu@desserud.org2015-11-112015-11-121
1514954please merge llvm-toolchain-3.7 from Debianllvm-toolchain-3.7locutusofborg@debian.org2015-11-102015-11-133
1361951mke2fs asks for input when formatting over a partition tablepartman-ext3mathieu-tl@ubuntu.com2014-08-272015-11-12442
1515689Wrong mode on unix.socket when socket activatedlxdstgraber@ubuntu.com2015-11-122015-11-120
1515763Merge from debian 2.8.14-1.2gimpnoskcaj@ubuntu.com2015-11-122015-11-131
609106pbuilderrc manpage doesn't mention that quotes are needed around multiple componentspbuilderlocutusofborg@debian.org2010-07-232015-11-251951
816556pbuilder leaves $DISPLAY setpbuilderlocutusofborg@debian.org2011-07-262015-11-251583
1307909EXTRAPACKAGES not installedpbuilderlocutusofborg@debian.org2014-04-152015-11-25589
1511938please merge pbuilder from debianpbuilderlocutusofborg@debian.org2015-10-312015-12-0838
1509946Update to 3.18.0gdm3tim@feathertop.org2015-10-262015-11-1318
1510854please merge wicd from debianwicdlocutusofborg@debian.org2015-10-282015-11-1316
1501651ARM chroot issues: fatal error: rt_sigaction failuregolangmichael.hudson@canonical.com2015-11-122015-11-2311
1515031Release no-change rebuild for ocaml transitionllvm-toolchain-3.6lukasz.zemczak@canonical.com2015-11-102015-11-133
1515704[xenial] Guest session not workinglightdmseb128@ubuntu.com2015-11-122015-11-131
1513985ffmpeg test idct8x8 (SIMPLE-ARM) fails on ARM32 when built with binutils from the trunkbinutilsdoko@ubuntu.com2015-11-062015-11-1610
525674apt-check hangs, preventing login via SSHupdate-notifierchristian.ehrhardt@canonical.com2010-02-222015-11-132090
1515818apparmor profile has a typoisc-dhcpjamie@ubuntu.com2015-11-132015-11-130
1515463Broken juju LXC deploymentslxcstgraber@ubuntu.com2015-11-122015-11-142
1512323devices on devel-proposed/ubuntu do not boot with systemd 227-2ubuntu1systemdsteve.langasek@ubuntu.com2015-11-132015-11-152
1516444ld hangs indefinitely statically linking binutils on ppc64elutil-linuxsteve.langasek@ubuntu.com2015-11-152015-11-205
1516467browser plugin crashes in firefoxgnome-shelltim@feathertop.org2015-11-162015-11-160
1516405It saves file with "Unsaved Document" name instead of "Untitled Document"geditseb128@ubuntu.com2015-11-152015-11-161
1516585imapfilter: core dump on initialisation following disabling of SSL3 in libsslimapfilterapw@ubuntu.com2015-11-162015-11-160
1516526xenial ubuntu-touch rootfs fail to buildlivecd-rootfsogra@ubuntu.com2015-11-162015-11-160
1516640config-changed hook fails with virt-type=lxdnova-compute-lxdzulcss@ubuntu.com2015-11-162015-11-193
1515980 dependency problems prevent configuration of gdmgdm3tim@feathertop.org2015-11-132015-11-174
1515911unity-control-center is not fully translatedgnome-menusseb128@ubuntu.com2015-11-132015-11-174
1515561Windows flash black briefly before being drawngtk+3.0iain.lane@canonical.com2015-11-122015-11-208
1473333exits with zero on errorgoget-ubuntu-touchsergio.schvezov@canonical.com2015-07-102015-11-18131
1508481lxcfs does not properly enforce directory escapeslxcfsserge.hallyn@ubuntu.com2015-10-212015-11-1727
1517385/usr/lib/unity-settings-daemon/unity-settings-daemon:5:g_settings_schema_get_value:g_settings_schema_key_init:g_settings_get_value:set_wacom_settings:device_added_cbgnome-settings-daemonseb128@ubuntu.com2015-11-182015-11-191
1511899init-system-helpers and upstart need to conflict/replaceinit-system-helpersrobie.basak@ubuntu.com2015-10-312015-11-2020
1507151sysv-rc.postinst calls insserv by name, but insserv package does not provide the command in a bin directorysysvinitrobie.basak@ubuntu.com2015-10-172015-11-2034
1455828machinctl/systemd-nspawn containers/processes end in wrong slicesystemdmartin.pitt@ubuntu.com2015-05-162015-11-20188
1514141unprivileged user can freeze journald systemdmartin.pitt@ubuntu.com2015-11-082015-11-2012
1516009systemd: TypeError in networkd testsystemdmartin.pitt@ubuntu.com2015-11-132015-11-207
1516971LXC's preserve_ns fails on < 3.8 kernelslxcstgraber@ubuntu.com2015-11-172015-11-192
1517107$PATH is getting clobbered when starting a container with Upstartlxcstgraber@ubuntu.com2015-11-172015-11-192
1446828gdb pretty printers do not auto-load on Trustygcc-4.8doko@ubuntu.com2015-04-212015-11-26219
1514309Undefined Behavior in GCC 4.8 ios_base.hgcc-4.8doko@ubuntu.com2015-11-092015-11-2617
1517093HTM builtins aren't treated as compiler barriers on powerpcgcc-4.8doko@ubuntu.com2015-11-182015-11-268
1517586can't boot to disk from netboot on power8grub2mathieu-tl@ubuntu.com2015-11-182015-11-191
1463680mirrors only added to mirrors.cfg, never removedubuntu-release-upgraderbrian@ubuntu.com2015-06-102015-11-19162
1511783release upgrader can create a too minimal sources.listubuntu-release-upgraderbrian@ubuntu.com2015-10-302015-11-1920
1506187[SRU] Azure: cloud-init should use VM unique IDcloud-initben.howard@ubuntu.com2015-10-142015-11-1835
1517975[SRU] FTBFS python 0.18 on Ubuntu 14.04python-pylxdzulcss@ubuntu.com2015-11-192015-11-190
1515758Merge from debian 2.0.18-1webtestnoskcaj@ubuntu.com2015-11-122015-11-197
1518023pip3 installs under python3.5python-pipbarry@ubuntu.com2015-11-192015-11-201
1511108Handle odd buffer lengths in checksumsbsigntoolmterry@ubuntu.com2015-10-282015-11-2023
1511154xdg-settings set fails with status 2 because of a small glitchxdg-utilsmterry@ubuntu.com2015-10-282015-11-2023
1503034Autofs 5.1.1-1ubuntu2 crashes with segfault on startupautofsmterry@ubuntu.com2015-10-052015-11-1945
1518117Do not restart on upgradelxcfsserge.hallyn@ubuntu.com2015-11-192015-11-201
1516831XDMCP Request packet with no addresses crashes LightDMlightdmrobert.ancell@canonical.com2015-11-202015-12-0414
1517685XDMCP server starts without authentication if configured key does not existlightdmrobert.ancell@canonical.com2015-11-202015-12-0414
1498562bliptv service has been closed, should disable the optiongrilo-pluginstim@feathertop.org2015-09-222015-11-2059
984093vino http server binds to external interfaces despite local_only configurationvinoseb128@ubuntu.com2012-04-172015-11-201312
987287vino-server crashed with SIGABRT in __libc_message()vinoseb128@ubuntu.com2012-04-232015-11-201306
1511364stack trace if you remove .data after mirrorsimplestreamssmoser@ubuntu.com2015-10-292015-11-2022
1518462assert in malloc.h at realloclxcfsserge.hallyn@ubuntu.com2015-11-202015-11-200
1518598SRU tracking bug for Plasma 5.4.3bluedevilyofel@kubuntu.org2015-11-212015-12-1019
1518478update paths in scripts to /etc/gdm3caspertim@feathertop.org2015-11-202015-11-233
1510824PolkitAgentSession incorrectly handles multiline output (as observed with pam_vas)policykit-1dariusz.gadomski@canonical.com2015-10-282015-11-2326
1518747Merge 3.18.2 from debiangnome-musicnoskcaj@ubuntu.com2015-11-222015-11-231
1440375oneconf-common should use python3 by defaultoneconfbarry@ubuntu.com2015-04-042015-11-23233
1517793geoclue crashed with SIGSEGVgeoclue-2.0seb128@ubuntu.com2015-11-192015-11-234
1519030cve-2015-4491 fails with MALLOC_CHECK_=2 and MALLOC_PERTURB_=$((${RANDOM:-256} % 256)), sometimeslibvirtxnox@ubuntu.com2015-11-232016-04-15144
1519079Xenial container on Xenial host no longer runs systemd and can't get an IP addresslxcfsserge.hallyn@ubuntu.com2015-11-232015-11-241
879943Synaptic messes sources.list and sources.list.dsoftware-propertiesmathieu-tl@ubuntu.com2011-10-222015-11-231493
1512589partman-efi should follow partman-auto/disk to reuse the ESP.partman-efisylee@canonical.com2015-11-032016-04-06155
1519228Drop obsolete dh_installinit --upstart-only optionavahimartin.pitt@ubuntu.com2015-11-242015-11-240
1466290Update to 3.16gnome-online-accountsiain@orangesquash.org.uk2015-06-182015-11-24159
1516005iscsitarget: build failures against kernel 4.3iscsitargetstefan.bader@canonical.com2015-11-132015-11-2512
1516543dpdk-init depends on executables in /usr/bindpdkstefan.bader@canonical.com2015-11-162015-11-248
1517075dpdk-dev contains no makefile templatesdpdkstefan.bader@canonical.com2015-11-172015-11-247
1515461Open menu dropdown is 'compressed' & unintelligible geditseb128@ubuntu.com2015-11-122015-11-2412
1518517Enabling the sidebar in gedit loses close,min,max buttons in ubuntu sessiongeditseb128@ubuntu.com2015-11-212015-11-243
1476467snapcraft is mixing the string literals, some with ' and some with "snapcraftsergio.schvezov@canonical.com2015-07-212015-11-24126
1477638snapcraft uses % to format stringssnapcraftsergio.schvezov@canonical.com2015-07-232015-11-24124
1478052copy plugin doesn't handle directoriessnapcraftsergio.schvezov@canonical.com2015-07-242015-11-24123
1478054copy plugin doesn't support globssnapcraftsergio.schvezov@canonical.com2015-07-242015-11-24123
1499240User friendly error missing when using go's source entry incorrectlysnapcraftsergio.schvezov@canonical.com2015-09-242015-11-2461
1499242subprocess.CalledProcessError: Command '['ssh', '-i', '/home/daniel/.ssh/ubuntudevice_0149BDCB0C009017_id_rsa', '-oStrictHostKeyChecking=no', '-oUserKnownHostsFile=/tmp/tmpcaocvoj7', '-oKbdInteractiveAuthentication=no', '-p', '8022', 'ubuntu@localhost']' returned non-zero exit status 1snapcraftsergio.schvezov@canonical.com2015-09-242015-11-2461
1500375inconsistent build results due to wrong usage of recommendssnapcraftsergio.schvezov@canonical.com2015-09-282015-11-2457
1502105when two python3 parts are used the pycs give a conflictsnapcraftsergio.schvezov@canonical.com2015-10-022015-11-2453
1502132Allow passing multiple requirements in the python plugin via a list in the snapcraft.yamlsnapcraftsergio.schvezov@canonical.com2015-10-022015-11-2453
1502410No visual indication that snappy build is runningsnapcraftsergio.schvezov@canonical.com2015-10-032015-11-2452
1507357Fail to build snap python3 distutils projectsnapcraftsergio.schvezov@canonical.com2015-10-182015-11-2437
1513935when the host doesn't have installed a library needed by a go snap, the build failssnapcraftsergio.schvezov@canonical.com2015-11-062015-11-2418
1515132Snapcraft crashes after defining a local source for a golang projectsnapcraftsergio.schvezov@canonical.com2015-11-112015-11-2413
1516228missing " git://" in the source crashes the snapcraftsnapcraftsergio.schvezov@canonical.com2015-11-142015-11-2410
1516404Python scripts can't be used as a 'binary'snapcraftsergio.schvezov@canonical.com2015-11-152015-11-249
1518403nodejs pluginsnapcraftsergio.schvezov@canonical.com2015-11-202015-11-244
1518404Add a nil pluginsnapcraftsergio.schvezov@canonical.com2015-11-202015-11-244
1516688Port to Python 3apt-xapian-indexbarry@ubuntu.com2015-11-162015-12-1428
1519756Display reminder dialog + notification (with actions)evolutionseb128@ubuntu.com2015-11-252015-11-250
1517582flash-kernel causes postinsts to fail when it happens to be installed on an unsupported system flash-kernelogra@ubuntu.com2015-11-182015-11-257
1516000dm-writeboost: build failures against kernel 4.3dm-writeboostapw@ubuntu.com2015-11-132015-11-2613
1516004flashcache: build failures against kernel 4.3 flashcacheapw@ubuntu.com2015-11-132015-11-2613
1516013rtl8812au: ADT test faliures against Ubuntu 4.3 kernelrtl8812auapw@ubuntu.com2015-11-132015-11-2714
1520527please merge pbuilder 0.221.1 from debianpbuilderlocutusofborg@debian.org2015-11-272015-11-270
1520154/etc/os-release should contain "codename" (like DISTRIB_CODENAME in lsb_release)base-filesmichael.vogt@ubuntu.com2015-11-262015-11-271
1303275dkms_packages.py crashed with TypeError in __main__: Type str doesn't support the buffer APIdkmsmartin.pitt@ubuntu.com2014-04-062015-11-30603
1518813sharing panel fails to properly launch required daemonsgnome-user-sharetim@feathertop.org2015-11-232015-11-307
1518985Please merge suitesparse 1:4.4.5-2 (main) from Debian unstable (main)suitesparsegraham@nerve.org.za2015-11-232015-12-1017
1521240strongswan ftbfs on s390xstrongswanxnox@ubuntu.com2015-11-302015-11-300
1521255[SRU] FTBFS nclxd 0.18 on Ubuntu 14.04nova-compute-lxdzulcss@ubuntu.com2015-11-302015-12-022
1521257[SRU] LXD v0.22 doesnt send the image fingerprint when uploadnova-compute-lxdzulcss@ubuntu.com2015-11-302015-12-022
1521177TEST_P fails with new G++ because of Property_CopyBaseTypeConstructor_Test::gtest_registering_dummy_' defined but not usedgtestmarco@ubuntu.com2015-11-302015-11-300
1521234ftbfs in xenialsquid3xnox@ubuntu.com2015-11-302015-11-300
1505671Missing patches for CXL drilinuxtim.gardner@canonical.com2015-10-132015-12-0452
1509029[Hyper-V] Crash in hot-add/remove scsi devices (smp)linuxtim.gardner@canonical.com2015-10-222015-12-0443
1510405Direct firmware load for radeon/kaveri_sdma1.bin failed with error -2linuxtim.gardner@canonical.com2015-10-272015-12-0438
1515541debian/tests/control specified unconditional gcc-multilib which is not available on ppc64ellinuxtim.gardner@canonical.com2015-11-122015-12-0422
1515872Change some I/O driver from =y to =mlinuxtim.gardner@canonical.com2015-11-132015-12-0421
1519820xenial linux master-next FTBFS on s390x due to unsupported zfslinuxtim.gardner@canonical.com2015-11-252015-12-049
1519833s390x: xenial master-next needs a different linux-image split and new udebslinuxtim.gardner@canonical.com2015-11-252015-12-049
1521421linux: 4.3.0-0.9 -proposed trackerlinuxtim.gardner@canonical.com2015-12-012015-12-043
1515361Fop FTBFS on Ubuntu Xenial (synced version in -proposed)scilabgraham@nerve.org.za2015-11-112016-04-06147
1466234Apparmor denial for access to SNAP_APP_USER_DATA_PATH as rootubuntu-core-securityjamie@ubuntu.com2015-06-172015-12-02168
589433being able to reduce space between iconsnautilusseb128@ubuntu.com2010-06-032015-12-032009
1019298image preview size is small and not well orderednautilusseb128@ubuntu.com2012-06-292015-12-031252
1278437can't move link type .desktop files around on desktopnautilusseb128@ubuntu.com2014-02-102015-12-03661
1445595Empty trash from Launcher results in Nautilus window openingnautilusseb128@ubuntu.com2015-04-262015-12-03221
1463662Update to 3.18nautilusseb128@ubuntu.com2015-06-102015-12-03176
1512498gnome-terminal thinks it's Byobu Terminalbyobudidrocks@ubuntu.com2015-11-022015-12-0230
1516775snapcraft init with parts fails with required optionssnapcraftsergio.schvezov@canonical.com2015-11-162015-12-0115
1518150A Chinese character in the snapcraft.yaml crashes the snapcraftsnapcraftsergio.schvezov@canonical.com2015-11-202015-12-0111
1519702Unitialised shebang variablesnapcraftsergio.schvezov@canonical.com2015-11-252015-12-016
1519724"config failed" when configuring webcam-webui examplesnapcraftsergio.schvezov@canonical.com2015-11-252015-12-016
1520248snap with only scripts gets wrongs architecture setsnapcraftsergio.schvezov@canonical.com2015-11-262015-12-015
1204530yppasswd results in a segmentation fault when run on clients or servernischristian.ehrhardt@canonical.com2013-07-242015-12-02861
1521673Please merge rsyslog 8.14.0-2 (main) from Debian unstable (main)rsysloglouis.bouchard@ubuntu.com2015-12-012015-12-021
1521980LimitNOFILE and LimitNPROC not being observedlxdstgraber@ubuntu.com2015-12-022015-12-020
1521712power: commonise configs IBMVETH/IBMVSCSI and ensure both are in linux-image and udebslinuxapw@canonical.com2015-12-012015-12-043
1520687[MIR] golang-petname-devgolang-petnamekirkland@ubuntu.com2015-11-272015-12-0912
1197569Move from zeitgeist-1.0 to zeitgeist-2.0nautilusricotz@ubuntu.com2013-07-032015-12-03883
1516685Please rename source package 'nova-lxd'nova-lxdjames.page@ubuntu.com2015-11-162015-12-0721
1522531Do not promote 2.4+dfsg-5ubuntu1ppa2qemuserge.hallyn@ubuntu.com2015-12-032015-12-074
1521612Continued TFTP timeouts when PXE booting via grubgrub2mathieu-tl@ubuntu.com2015-12-012015-12-043
1521931apparmor-profile-load returns 1 if apparmor not installedupstartserge.hallyn@ubuntu.com2015-12-042015-12-073
1521952zfs-linux: auto remount fails on rebootzfs-linuxcolin.king@canonical.com2015-12-022015-12-086
1522210linux splits have s390 modules in extras package, rather than main onelinuxtim.gardner@canonical.com2015-12-032015-12-052
1522958linux: 4.3.0-2.11 -proposed trackerlinuxtim.gardner@canonical.com2015-12-042015-12-051
1518859[Feature]update firmware to -16.ucode for Intel wireless devicelinux-firmwareseth.forshee@canonical.com2015-11-232015-12-0613
1125726boot-time race between /etc/network/if-up.d/ntpdate and "/etc/init.d/ntp start"ntpiain@orangesquash.org.uk2013-02-152015-12-071025
1313199[patch] Update to fix minibuf-electric.el for Emacs 24emacs-goodies-eliain@orangesquash.org.uk2014-04-262015-12-07590
1522955nm-applet not installed with xenial daily isonetwork-manager-appletmathieu-tl@ubuntu.com2015-12-042015-12-073
1522849trim_dpkg_log raises exception on unexpected DpkgTerminalLogapportbrian@ubuntu.com2015-12-042015-12-073
1523653netscript-2.4 merge with debian 5.4.11netscript-2.4apw@ubuntu.com2015-12-072015-12-070
1509081nano segfaults as root after upgrade to 15.10nanomterry@ubuntu.com2015-10-222015-12-0746
1523699install delivers non-executable usr/share/node-gyp/bin/node-gyp.jsnode-gyplamont.jones@canonical.com2015-12-072015-12-070
1523750linux-raspi2: 4.3.0-1006.6 -proposed trackerlinux-raspi2tim.gardner@canonical.com2015-12-082015-12-168
1516947apport looping on an old crash dumpapportmartin.pitt@ubuntu.com2015-11-172015-12-0922
1523947npm does not work on Xenialnpmlamont.jones@canonical.com2015-12-082015-12-080
1523715[SRU] update walinuxagent to 2.1.2 to fix docker extension and enable AzureStackwalinuxagentben.howard@ubuntu.com2015-12-072015-12-081
1515986unable to properly install backuppc on wily 15.10backuppcnoskcaj@ubuntu.com2015-11-132015-12-0825
1409309Please update to virt-manager 1.2.1 in Wilyvirt-managermarc.deslauriers@ubuntu.com2015-01-102015-12-08332
1523682python3.5 contentsource.py:UrlContentSource passes -1 to fd.readsimplestreamssmoser@ubuntu.com2015-12-082015-12-080
1524304requires python-openssl >= 0.13.1python-pylxdjames.page@ubuntu.com2015-12-092015-12-090
1516047geonames should be uploaded to Ubuntugeonamesseb128@ubuntu.com2015-11-132015-12-1128
1522755lxc exec outputs stderr on host's stdoutlxdstgraber@ubuntu.com2015-12-042015-12-095
1498633drivers/net/ethernet/atheros/alx: please add device ID for Killer E2400linuxapw@canonical.com2015-09-222016-01-04104
1524319s390x: enable tools packageslinuxapw@canonical.com2015-12-092016-01-0426
1524426linux: 4.3.0-3.12 -proposed trackerlinuxapw@canonical.com2015-12-092016-01-0426
1524700generate html documentation onlydpdkjames.page@ubuntu.com2015-12-102015-12-100
1381973keyutils ftbfs on the buildds with the 12.04 LTS kernelkeyutilslocutusofborg@debian.org2014-10-162015-12-10420
706774apt-get not used as package managerppa-purgetim@feathertop.org2011-01-242015-12-111782
1064205feature request on ppa-name bash-completionppa-purgetim@feathertop.org2012-10-092015-12-111158
1392954Handle soname bumps in package namesppa-purgetim@feathertop.org2014-11-152015-12-11391
1524474Merge from debian 4.12.3-2xfdesktop4noskcaj@ubuntu.com2015-12-092015-12-112
1524937Install plymouth-themes missing xubuntu-text.soplymouthdidrocks@ubuntu.com2015-12-102015-12-111
1525122please merge llvm-toolchain-3.7 from Debianllvm-toolchain-3.7locutusofborg@debian.org2015-12-112015-12-110
1502781Bluetooth 0930:021c not working in Ubuntu 15.10linuxtim.gardner@canonical.com2015-10-052016-01-0491
1506615Bluetooth not finding any devicelinuxtim.gardner@canonical.com2015-10-152016-01-0481
1525251linux: 4.3.0-4.13 -proposed trackerlinuxtim.gardner@canonical.com2015-12-112016-01-0424
1524008/usr/bin/nautilus:ERROR:nautilus-file.c:7046:nautilus_file_is_in_trash: assertion failed: (NAUTILUS_IS_FILE (file))nautilusseb128@ubuntu.com2015-12-082015-12-113
1524553s390x from xenial has broken zipls390-toolsxnox@ubuntu.com2015-12-102015-12-111
1524480package plymouth 0.9.2-3ubuntu2 failed to install/upgrade: subprocess installed pre-removal script returned error exit status 1plymouthsteve.langasek@ubuntu.com2015-12-092016-01-0830
1525393xenial secureboot images not signeddebian-installeradconrad@ubuntu.com2015-12-112015-12-121
1523834ubuntu-mate-settings 16.04.0 release [debdiff attached]ubuntu-mate-settingscode@flexion.org2015-12-082015-12-135
1520229Wrong Epson URLsimple-scanrobert.ancell@canonical.com2015-11-262015-12-1418
1499544Profile name length limitationclick-reviewers-toolsjamie@ubuntu.com2015-10-132016-02-22132
1510522Remove vendor from metaclick-reviewers-toolsjamie@ubuntu.com2015-11-092016-02-22105
1511063Scopes freeze after few times slide on Bq 4.5click-reviewers-toolsjamie@ubuntu.com2015-11-302015-12-1414
1514346Needs absolute path for clicks(?)click-reviewers-toolsjamie@ubuntu.com2015-11-092016-02-22105
1517017Unknown fields in 'scope/com.ubuntu.telegram_sctelegram.ini': displayname[ast], description[ast], searchhint[ast]click-reviewers-toolsjamie@ubuntu.com2015-11-172016-02-2297
1522777IsADirectoryError: [Errno 21] Is a directory: '/tmp/clickreview-h712bz1m/'click-reviewers-toolsjamie@ubuntu.com2015-12-042016-02-2280
1521208Disable Online Search by default in Unity 7 Dashlibunitydidrocks@ubuntu.com2015-11-302015-12-1515
1502094libgee-0.8-dev should be used, libgee-dev will be removed from the archiveunity-lens-musicdidrocks@ubuntu.com2015-10-022015-11-2554
1526181u-s-d cursor plugin fails to load in xenialgnome-settings-daemonseb128@ubuntu.com2015-12-152015-12-150
1434573nautilus sigabrt in directory_count_stop when using move itemnautilusseb128@ubuntu.com2015-03-202015-12-15270
1520411powerpc/tm: Fix local DoS linuxapw@canonical.com2015-11-272016-01-0438
1525297nic-modules udeb missing s390 moduleslinuxapw@canonical.com2015-12-112016-01-0424
1526295linux: 4.3.0-5.14 -proposed trackerlinuxapw@canonical.com2015-12-152016-01-0420
1518800[MIR] dnspython3dnspython3andreserl@ubuntu.com2015-11-232015-12-1825
1525841xubuntu and lubuntu (maybe other flavors?) don't display plymouth text theme on liveplymouthdidrocks@ubuntu.com2015-12-142015-12-162
1452201fwts PCIe ASPM tests are throwing Segmentation faultfwtsalex.hung@ubuntu.com2015-05-062015-12-18226
1519425fwts: update to lastest version of ACPICA 20151124fwtsalex.hung@ubuntu.com2015-11-242015-12-1622
1522292FWTS does not provide time to suspend when testing s3fwtsalex.hung@ubuntu.com2015-12-032015-12-1613
1524217fwts: segfault in method test (ACPICA)fwtsalex.hung@ubuntu.com2015-12-092015-12-167
1526654The barbican package is missing a dependancy on uwsgi-plugin-pythonbarbicancorey.bryant@canonical.com2015-12-162015-12-182
1526655/etc/barbican/policy.json is missing from barbican packagebarbicancorey.bryant@canonical.com2015-12-162015-12-182
1526659 The barbican package is missing a dependancy on python-pymysqlbarbicancorey.bryant@canonical.com2015-12-162015-12-182
1522316Icons are too bigubuntu-settingsseb128@ubuntu.com2015-12-162015-12-160
1515207/bin/login aborted due to pointer double free in libpam.sosambaseb128@ubuntu.com2015-11-112015-12-1635
1526450/usr/sbin/update-apt-xapian-index:ImportError:/usr/sbin/update-apt-xapian-index@104:setupIndexing:__init__:__init__:load_source:_load:_load_unlocked:exec_module:_call_with_frames_removed:/usr/share/apt-xapian-index/plugins/software_center.py@13:/usr/share/software-center/softwarecenter/db/update.py@33:/usr/share/software-center/softwarecenter/backend/scagent.py@26software-centeriain@orangesquash.org.uk2015-12-152015-12-161
1032823package libdevmapper-event1.02.1 2:1.02.48-4ubuntu7.1 failed to install/upgrade: ErrorMessage: dependency problems - leaving unconfiguredlvm2martin.pitt@ubuntu.com2012-08-032015-12-161230
1526358adding seccomp rule for socket() fails on i386 since kernel 4.3libseccompapw@ubuntu.com2015-12-162015-12-171
1526801networking qeustion for qeth defaults to L3 mode, it should be L2 mode.s390-netdevicexnox@ubuntu.com2015-12-162015-12-160
1510096Please merge 1.9.6-2 (main) from Debian Unstable (main)nginxteward@ubuntu.com2015-10-262015-12-1651
1526267Traceback from update-apt-xapian-indexapt-xapian-indexbarry@ubuntu.com2015-12-152015-12-161
1526799installed system did not bring up installed DASD device onlines390-dasdxnox@ubuntu.com2015-12-162015-12-160
1526894Should clean < xenial conffile on upgradegnome-user-sharetim@feathertop.org2015-12-162015-12-160
1526869should be able to do live-installer installs from mirrors, and cdrom pool over the networklinuxtim.gardner@canonical.com2015-12-162016-01-0419
1526962linux: 4.3.0-5.15 -proposed trackerlinuxtim.gardner@canonical.com2015-12-162016-01-0419
1526986linux: 4.3.0-5.16 -proposed trackerlinuxtim.gardner@canonical.com2015-12-162016-01-0419
1517615Unity System Compositor --enable-hardware-cursor=true option no longer required.lightdmrobert.ancell@canonical.com2015-11-182015-12-1729
1526004guest-session DIALOG_SLEEP not definedlightdmrobert.ancell@canonical.com2015-12-142015-12-173
1523606Incompatibility with 4.2 prints: crash: page excluded: kernel virtual address: ffff88105b1a0000 type: "fill_task_struct"crashchiluk@canonical.com2015-12-072015-12-1710
1485345FileZilla version is outdatedfilezillalocutusofborg@debian.org2015-08-162015-12-17123
1509989Filezilla : Site Manager crash (assertion failed) only with Ubuntu 15.10filezillalocutusofborg@debian.org2015-10-262015-12-1752
1527125please merge filezilla from debianfilezillalocutusofborg@debian.org2015-12-172015-12-170
1527086new Startup Disk Creator cannot clone mini.isousb-creatormarc.deslauriers@ubuntu.com2015-12-172015-12-181
1524737systemd presents hugetblfs at /dev/hugepageslibvirtserge.hallyn@ubuntu.com2015-12-102015-12-2818
1508110Users tab doesn't work as expectedlandscape-clientfree.ekanayaka@canonical.com2015-12-152016-03-1086
1526959openssl 1.0.2e breaks sbsigntoolsbsigntoolmathieu-tl@ubuntu.com2015-12-162015-12-182
1526777default mirror is not pre-selected to ports archivechoose-mirrorxnox@ubuntu.com2015-12-172015-12-170
1526778default "sub-directory" for ports mirror, is not /ubuntu-ports/choose-mirrorxnox@ubuntu.com2015-12-162015-12-171
1511980fcitx panel icon is wronglubuntu-artworkgilir@ubuntu.com2015-10-312015-12-2151
1527745plugin/sizes.py crashes on 32 bit system for big packagesapt-xapian-indexbarry@ubuntu.com2015-12-182015-12-191
1527741oxide-qt 1.11.3-0ubuntu2 FTBFS on armhf due to compiler segfaultgcc-5doko@ubuntu.com2015-12-182015-12-202
666726typo in comand-line to restart dhcpd3installation-guidesteve.langasek@ubuntu.com2010-10-262015-12-211882
881984remove the example of preseeding X configurationinstallation-guidesteve.langasek@ubuntu.com2011-10-262015-12-211517
887663Merge with Debian 20110122installation-guidesteve.langasek@ubuntu.com2011-11-082015-12-211504
1000354reference to 2.6 kernels, no mention about 3.2 installation-guidesteve.langasek@ubuntu.com2012-05-162015-12-211314
1019906Incorrect info. make-kpkg fails with '--revision=custom.1.0' , must have digit first correct form is 'make-kpkg --revision=1.0.custom'installation-guidesteve.langasek@ubuntu.com2012-07-022015-12-211267
1030336typo in installation instructions - minimum requirements pageinstallation-guidesteve.langasek@ubuntu.com2012-07-282015-12-211241
1233732Documentation: "debian-installer source repository" URL brokeninstallation-guidesteve.langasek@ubuntu.com2013-10-012015-12-21811
1316242Preseed example needs an updateinstallation-guidesteve.langasek@ubuntu.com2014-05-052015-12-22596
1391019installation guide needs to point to ports.ubuntu.com for PowerPC imagesinstallation-guidesteve.langasek@ubuntu.com2014-11-102015-12-21406
1524889Metacity Iconmetacitysubins2000@gmail.com2015-12-102015-12-2111
1527923Merge 0.6.3-2 from debianxfce4-terminalnoskcaj@ubuntu.com2015-12-192015-12-234
1527919Merge gimp 2.8.16-1gimpnoskcaj@ubuntu.com2015-12-192015-12-212
1524490Merge 2.0.3-1 from debianbluemannoskcaj@ubuntu.com2015-12-092015-12-2819
1518440tgt fails to install in LXDtgtmterry@ubuntu.com2015-11-202016-02-2294
1524982Please merge tgt 1.0.61-1 (main) from Debian unstable (main)tgtmterry@ubuntu.com2015-12-102015-12-2111
1521043less 458 crashes if search regex has many groupslessrhansen@rhansen.org2015-11-302015-12-2121
1528545inn: ftbfs due to multiple implicit function castsinnapw@ubuntu.com2015-12-222016-01-0615
1528389Merge from debian 0.8.0-2.1gnome-activity-journalnoskcaj@ubuntu.com2015-12-212015-12-221
1528530tasksel package is missing /usr/lib/tasksel/filter-tasks file which prevent system from installtaskselmathieu-tl@ubuntu.com2015-12-222015-12-220
1507002"boot error" due to gcc v5 transitionsyslinuxmterry@ubuntu.com2015-10-162016-02-24131
1519152unicode-math package results in Undefined control sequence \__um_set_big_operator:nnntexlive-baseandersk@mit.edu2015-11-242015-12-2329
1480718context menu open link in new window seems to do nothing. ubuntu-mate-welcomecode@flexion.org2015-08-022015-12-24144
1500533Ubuntu Mate Welcome can't install any software when OS installed without internet connectionubuntu-mate-welcomecode@flexion.org2015-09-282015-12-2487
1525934 ubuntu-mate-welcome 16.04.0 new release [debdiff attached]ubuntu-mate-welcomecode@flexion.org2015-12-142015-12-2410
1509712Missing desktop and computer icons for Ambiant-MATE / Radiant-MATE themesubuntu-mate-artworkcode@flexion.org2015-10-242016-01-0169
1515557Sidebars have too little paddingubuntu-mate-artworkcode@flexion.org2015-11-122015-11-2715
1525896ubuntu-mate-artwork 16.04.0 new release [debdiff attached]ubuntu-mate-artworkcode@flexion.org2015-12-142015-12-2410
1523657Merge meta-gnome3 1:3.14+3 (universe) from Debian unstable (main)meta-gnome3bryan.quigley@canonical.com2015-12-072015-12-3023
1506980xemacs21: ftbfs with GCC-5xemacs21ari-tczew@ubuntu.com2015-10-162015-12-2873
518056cedilla appears as accented c (ć instead of ç) when typing 'clanguage-selectorgunnarhj@ubuntu.com2015-04-012015-12-29272
1529297[Xenial] 2015-12-25 ISOs (multiple ones) leave 'deb' line for CDROM uncommented after installapt-setupcjwatson@ubuntu.com2015-12-252015-12-305
1527353ubiquity shows for a second goes to tty then starts live session. ubiquitycjwatson@ubuntu.com2015-12-172015-12-3114
1530397tasksel in d-i does not install all of lubuntu-desktoptaskselcjwatson@ubuntu.com2015-12-312016-01-022
616447Launcher - Quit does not actually quit applicationsrhythmboxsoftware@tim-hollmann.de2015-10-142016-01-0482
1528728gnome-terminal starts up at 79×23 instead of 80×24vte2.91andersk@mit.edu2015-12-232016-01-1119
1445616[MIR] crmsh in vivid/wily/xenial is not compatible with pacemakercrmshjames.page@ubuntu.com2015-04-172016-01-04262
1525525please merge boost1.58 from Debianboost1.58locutusofborg@debian.org2015-12-122016-01-0625
915651Many fortunes point to dead URLsfortunes-ubuntu-servermcintire.evan@gmail.com2012-01-122016-01-041453
1458260Grammer Correctionfortunes-ubuntu-servermcintire.evan@gmail.com2015-05-232016-01-04226
1530949please merge gambas3 from debiangambas3locutusofborg@debian.org2016-01-042016-01-062
1530483rsyslog's apparmor profile is missing a rule for systemd integrationrsyslogjamie@ubuntu.com2016-01-012016-01-065
1529074Due to AppArmor profile restrictions Telepathy can't connect when networkd used instead of NetworkManagerapparmorjamie@ubuntu.com2015-12-242016-01-0613
1531225[SRU] Add support for mitaka cloud-archivesoftware-propertiescorey.bryant@canonical.com2016-01-052016-01-050
1527884Firefox 43.0: Downloads failfirefoxchris.coulson@canonical.com2015-12-192016-01-0719
1528297libvpx FTBFS with gcc 5.3 on armhffirefoxchris.coulson@canonical.com2015-12-222016-01-2635
1511286Disable greeters from loading KDE's debug handersddmyofel@kubuntu.org2015-10-292016-01-0669
1516837[update request] SDDM 0.13.0 released on Nov. 4thsddmyofel@kubuntu.org2015-11-172016-01-0650
1519564[merge request] SDDM 0.12.0 released on Sept. 5thsddmyofel@kubuntu.org2015-11-252016-01-0642
1531191qemu-kvm-init script called with undefined $KVM_HUGEPAGESqemuserge.hallyn@ubuntu.com2016-01-052016-01-072
1098814New upstream release: 1.27.1libgdamm5.0logan@ubuntu.com2014-08-182016-01-06506
1306960update to pencil2Dpencil2dmapreri@ubuntu.com2016-01-042016-01-062
1527865llvm-toolchain-3.7 FTBFS on i386 [SRU]llvm-toolchain-3.7locutusofborg@debian.org2015-12-192016-01-0719
1528688scsi-firmware udeb does not include ql2500_fw.binlinux-firmwareseth.forshee@canonical.com2015-12-222016-01-0615
1531070package plymouth 0.8.8-0ubuntu17.1 failed to install/upgrade: trying to overwrite '/usr/share/apport/package-hooks/source_plymouth.py', which is also in package libplymouth2:amd64 0.8.8-0ubuntu17.1plymouthdidrocks@ubuntu.com2016-01-052016-01-072
1531685package ifupdown 0.8.5ubuntu1 failed to install/upgrade: Unterprozess installiertes pre-removal-Skript gab den Fehlerwert 1 zurückifupdownmartin.pitt@ubuntu.com2016-01-072016-01-070
1531358lxc doesn't have bash command line completionlxdstgraber@ubuntu.com2016-01-062016-01-082
1401783Requirement "argparse" breaks package importstevedorecjwatson@ubuntu.com2014-12-122016-01-08392
1531465/usr/share/sddm/scripts/Xsetup is overwritten on updatessddmyofel@kubuntu.org2016-01-062016-01-082
1191673dvipng should depend on latex-xcolordvipngdoko@ubuntu.com2013-06-172016-01-08935
1505088Surelock: GA2: ppc64-diag package opal_errd not autostarting on Ubuntu 15.10 (in systemd)ppc64-diagsteve.langasek@ubuntu.com2015-10-122016-01-1191
1484233Built in NTP template opens up wrong portgui-ufwd.filoni@ubuntu.com2015-08-122015-11-0787
1527685Please merge freeipmi 1.4.11-1 (main) from Debian unstable (main)freeipmisteve.langasek@ubuntu.com2015-12-182016-01-1427
1532716 llvm-toolchain-3.7 FTBFS on powerpc and s390x [SRU]llvm-toolchain-3.7locutusofborg@debian.org2016-01-112016-01-110
1531722virt-manager on 16.04 as host does not allow creation of 16.04 or 15.10 virtual machineslibosinfoiain@orangesquash.org.uk2016-01-072016-01-114
1532135Value type enums are not exposed to QML with Qt5.5oxide-qtchris.coulson@canonical.com2016-01-082016-01-135
1532887Frequent resyncs after users tab fixlandscape-clientandreas@canonical.com2016-01-112016-01-110
1531564missing apparmor rule to read /sys/module/vhost/parameters/max_mem_regionslibvirtserge.hallyn@ubuntu.com2016-01-062016-01-115
1529319VM constantly tries to access /run/shm/lttng-ust-wait-5libvirtserge.hallyn@ubuntu.com2015-12-262016-01-1116
1486180Kernel OOPS during DLPAR operation with Fibre Channel adapterlinuxtim.gardner@canonical.com2015-08-182016-01-19154
1526811SRU: walker list corruption while being intensively stressedlinuxtim.gardner@canonical.com2015-12-162016-01-1934
1526946Surelock GA2: Kernel panic with GA candidate driver, warning at kernel/rcu/tree.c:2694linuxtim.gardner@canonical.com2015-12-162016-01-1934
1527096System locks up when Inserting a SD card on a baytrail platformlinuxtim.gardner@canonical.com2015-12-172015-12-214
1527374CVE-2015-8709linuxtim.gardner@canonical.com2015-12-172016-01-1933
1528904CVE-2015-8660linuxtim.gardner@canonical.com2015-12-232016-01-1927
1532886s390x kernels are inconsistent for cloud stufflinuxtim.gardner@canonical.com2016-01-112016-01-198
1532958linux: 4.3.0-6.17 -proposed trackerlinuxtim.gardner@canonical.com2016-01-112016-01-198
1517625Typo in hooks/biosdevnamebiosdevnamebrian@ubuntu.com2015-11-182016-01-1255
1532722/sbin/ifup:11:__GI_strncpy:strncpy:do_interface:mainifupdownmartin.pitt@ubuntu.com2016-01-112016-01-121
1529431Add insert-text icon to non-full icon packagegnome-icon-themeseb128@ubuntu.com2015-12-272016-02-2257
1532370 gschema default for DnD hover in canvas view should be falseubuntu-settingsseb128@ubuntu.com2016-01-092016-01-123
1533101gcc crashes when building Oxide againgcc-5doko@ubuntu.com2016-01-122016-01-131
1518035package libjpeg-progs 1:9a-2ubuntu1 failed to install/upgrade: trying to overwrite '/usr/share/man/man1/djpeg.1.gz', which is also in package libjpeg-turbo-progs 1.3.0-0ubuntu2libjpeg-turbodoko@ubuntu.com2015-11-202016-01-1253
1532581package libjpeg-turbo-progs 1.3.0-0ubuntu2 failed to install/upgrade: intentando sobreescribir `/usr/bin/jpegtran', que está también en el paquete libjpeg-progs 1:9a-2ubuntu1libjpeg-turbodoko@ubuntu.com2016-01-102016-01-122
1499226Apport: Enhances PowerPC hook to capture more information over PowerNVapportbrian@ubuntu.com2015-09-242016-01-13111
1307069gpu-manager causing long startup delaysubuntu-drivers-commonalberto.milone@canonical.com2014-04-132016-01-13640
1485236gpu-manager generates an invalid xorg.conf fileubuntu-drivers-commonalberto.milone@canonical.com2015-08-152016-01-13151
1500109byobu-shell: respect ~/.hushlogin filebyobukirkland@ubuntu.com2015-09-262016-01-14110
1526844readline error on launch - Macbyobukirkland@ubuntu.com2015-12-162016-01-1429
1526746fwts: add more checks to klog databasefwtsivan.hu@ubuntu.com2015-12-162016-01-1328
1526815uefirtvariable.c - Declared variable-length array (VLA) has zero sizefwtsivan.hu@ubuntu.com2015-12-162016-01-1429
1527733fwts: update to lastest version of ACPICA 20151218fwtsivan.hu@ubuntu.com2015-12-182016-01-1326
1529717FWTS syntaxcheck failure on Remark #2011 ASL_MSG_COMPILER_RESERVEDfwtsivan.hu@ubuntu.com2015-12-282016-01-1316
1532103fwts: add esrt dumping on fwtsfwtsivan.hu@ubuntu.com2016-01-082016-01-146
1532268fwts: update to lastest version of ACPICA 20160108fwtsivan.hu@ubuntu.com2016-01-082016-01-135
1533014aodh can't be installedaodhcorey.bryant@canonical.com2016-01-142016-01-140
1186662isc-dhcp-server fails to renew lease fileisc-dhcpmathieu-tl@ubuntu.com2013-06-022016-01-15957
1533453fonts-tlwg-*-ttf packages fail to upgrade from 1:0.6.2-1fonts-tlwgiain@orangesquash.org.uk2016-01-132016-01-141
1525996missing patch in USN-2834-1 security updateslibxml2marc.deslauriers@ubuntu.com2015-12-142016-01-1936
153119413.04 "raring-partner" channel included in 14.04/15.04/15.10/16.04app-install-data-partnerbrian@ubuntu.com2016-01-052016-01-149
1521681[Ubuntu 16.04] lsvpd package updatelsvpdmathieu-tl@ubuntu.com2015-12-012016-01-1545
1521680[Ubuntu 16.04] ppc64-diag package updateppc64-diagmathieu-tl@ubuntu.com2015-12-012016-01-1545
1522410[Ubuntu 16.04] Enable P9 toolchaingcc-5doko@ubuntu.com2015-12-032016-01-1846
1534346FTBFS with golang-go 1.6golang-x-textxnox@ubuntu.com2016-01-142016-01-140
1534157alsamixer controls pulseaudio volume by defaultalsa-utilsthemuso@ubuntu.com2016-01-142016-01-151
1532615etckeeper init is not executed on initial installetckeepernobuto@ubuntu.com2016-01-102016-01-155
1524165merge with debiangolangmichael.hudson@canonical.com2015-12-092016-01-1537
1534208Please merge 1.9.9-1 (main) from Debian Unstable (main)nginxteward@ubuntu.com2016-01-142016-01-151
1534368HTTP/2 is not enabled for nginx-extrasnginxteward@ubuntu.com2016-01-142016-01-151
1534487cgroup change failed (freezer) when using sudocgmanagerserge.hallyn@ubuntu.com2016-01-152016-01-183
1468027change default CJK fonts to Noto CJKlanguage-selectorgunnarhj@ubuntu.com2015-06-232016-04-05287
720613natty fai: FAI_DEBOOTSTRAP should be adapted to natty specific valuesfaiari-tczew@ubuntu.com2011-02-172016-01-171795
1443771Fai packages are not updatedfaiari-tczew@ubuntu.com2015-04-142016-01-17278
1528791Update mstflint to the latest upstream mstflintari-tczew@ubuntu.com2015-12-232016-01-1826
1533839vms shutting down on libvirt upgradelibvirtmartin.pitt@ubuntu.com2016-01-132016-01-185
1534090'call to get_tasks_recursive failed' errors from sucgmanagerserge.hallyn@ubuntu.com2016-01-142016-01-184
1535494Fix numa_node_to_cpus patchnumactlserge.hallyn@ubuntu.com2016-01-192016-01-190
1534764xenial lxd (-root.tar.gz/-root.tar.xz) have unnecessary packageslivecd-rootfsutlemming.howard@ubuntu.com2016-01-152016-01-194
1357424Please merge amavisd-new_2.9.0-1 (main) from Debian unstable (main)amavisd-newpierre-andre.morey@canonical.com2014-08-152016-01-19522
1517040wpa 2.4 misses one patch from Debian to improve 2.4/5 GHz AP selectionwpatimo-jyrinki@ubuntu.com2015-11-172016-01-2064
1240198[SRU]Wrong keyboard layout active after booting into desktopibusiain@orangesquash.org.uk2014-05-232016-01-19606
1532648Please merge openldap 2.4.42+dfsg-2 (main) from Debian testing (main)openldapryan@nardis.ca2016-01-112016-01-209
1534991Please merge debian-multimedia 0.4 (universe) from Debian unstable (main)debian-multimediarossgammon@mail.dk2016-01-162016-01-193
1534887CVE-2016-0728linuxtim.gardner@canonical.com2016-01-162016-01-215
1535736linux: 4.3.0-7.18 -proposed trackerlinuxtim.gardner@canonical.com2016-01-192016-01-212
1508636Build with multiarch supportvte2.91noskcaj@ubuntu.com2015-10-212016-01-2091
1531262Please merge logwatch 7.4.1+svn20150731rev294 from Debianlogwatchnish.aravamudan@canonical.com2016-01-052016-01-1914
1535949handling of -dbgsym packages breaks pkgbinarymanglerdebhelpermartin.pitt@ubuntu.com2016-01-202016-01-200
1534966Upgrade to 0.32xf86-input-wacomtjaalton@debian.org2016-01-162016-01-204
1536093package libxapian-1.3-5 (not installed) failed to install/upgrade: trying to overwrite '/usr/share/xapian-core/stopwords/dutch.list', which is also in package libxapian-1.3-4 1.3.3-0ubuntu2xapian1.3-coredoko@ubuntu.com2016-01-202016-01-211
1530413confusing example from 'lxc help image'lxdstgraber@ubuntu.com2016-01-012016-01-2019
1530414lxc image copy should be (at least optionally) more verboselxdstgraber@ubuntu.com2016-01-012016-01-2019
1531357no command to rename an instance?lxdstgraber@ubuntu.com2016-01-062016-01-2014
1531643lxc restore help is unclearlxdstgraber@ubuntu.com2016-01-062016-01-2014
1535952isc-dhcp-server.service fails on xenial with "Can't open lease database /var/lib/dhcp/dhcpd.leases: No such file or directory"isc-dhcpmathieu-tl@ubuntu.com2016-01-202016-01-200
1532842New packaging format for 16.04snapcraftleo.arias@canonical.com2016-01-112016-01-2110
1533021Documentation refresh for 2.0 featuressnapcraftleo.arias@canonical.com2016-01-122016-01-219
1533293security-override in snapcraft needs to support 16.04 changessnapcraftleo.arias@canonical.com2016-01-122016-01-219
1533393Examples tests are not receiving the filter parametersnapcraftleo.arias@canonical.com2016-01-122016-01-219
1533397The static tests are run as part of the unit testssnapcraftleo.arias@canonical.com2016-01-122016-01-219
1533400The ssh module should not be exported in snapcraftsnapcraftleo.arias@canonical.com2016-01-122016-01-219
1533403There is no way for jenkins to collect the examples resultssnapcraftleo.arias@canonical.com2016-01-122016-01-219
1533552Please update snapcraft for new environment variablessnapcraftleo.arias@canonical.com2016-01-132016-01-218
1533736tomcat-maven-webapp example fails to install in rollingsnapcraftleo.arias@canonical.com2016-01-132016-01-218
1534150_wrap_exec should this the app name as the basename for the wrappersnapcraftleo.arias@canonical.com2016-01-142016-01-217
1534411Needs Test for Git sourcessnapcraftleo.arias@canonical.com2016-01-152016-01-216
1534784examples are missing the network-listener capabilitysnapcraftleo.arias@canonical.com2016-01-152016-01-216
1534800Files customized in .snap build process is clobbered if stage-package contains same filesnapcraftleo.arias@canonical.com2016-01-152016-01-216
1535309ros setup files lead to confined pathssnapcraftleo.arias@canonical.com2016-01-182016-01-213
1536568please merge openvpn from debianopenvpnlocutusofborg@debian.org2016-01-212016-01-210
1536299spl build failure on a clean install of Wilyspl-linuxcolin.king@canonical.com2016-01-202016-01-211
1517142ubuntu guest with 10G n/w and Texan iSCSI crashes during FIOlinuxtim.gardner@canonical.com2015-11-172016-02-0176
1536803linux: 4.4.0-1.15 -proposed trackerlinuxtim.gardner@canonical.com2016-01-212016-02-0111
575978Wrong keys in icelandic keyboard layoutxkeyboard-configtjaalton@debian.org2010-05-052016-01-222088
1536385update to latest version upstream to support Arabic macintoshxkeyboard-configtjaalton@debian.org2016-01-202016-01-222
1534999Please merge blends 0.6.92.5 (universe) from Debian unstable (main)blendsrossgammon@mail.dk2016-01-162016-01-226
1535922ubuntu-mate-settings 16.04.1 release [debdiff attached] ubuntu-mate-settingscode@flexion.org2016-01-192016-01-223
1530446Additional re-coloured icons for Ambiant-MATE / Radiant-MATEubuntu-mate-artworkcode@flexion.org2016-01-012016-01-2221
1535927ubuntu-mate-artwork 16.04.1 new release [debdiff attached]ubuntu-mate-artworkcode@flexion.org2016-01-192016-01-223
1535910Please update ubuntu-mate-meta for 16.04 Alpha 2ubuntu-mate-metatimo-jyrinki@ubuntu.com2016-01-192016-01-223
1530953Support GRUB's native root=ZFS=zfs-linuxcolin.king@canonical.com2016-01-042016-04-0895
1535428Missing "Provides: zfs" on zfsutils-linuxzfs-linuxcolin.king@canonical.com2016-01-182016-01-224
1530566privilege escalation by mounting over /proc/$pidecryptfs-utilskirkland@ubuntu.com2016-01-112016-01-2211
1537116lsvpd: Missing package dependencylsvpdsteve.langasek@ubuntu.com2016-01-222016-01-220
1527900Startup Disk Creator cannot fetch iso files from a directory with non-standard charactersusb-creatormarc.deslauriers@ubuntu.com2015-12-192016-01-2234
1535897Add quick document about how to write your own pluginsnapcraftsergio.schvezov@canonical.com2016-01-192016-01-245
1536860'snapcraft init' template contains vendorsnapcraftsergio.schvezov@canonical.com2016-01-222016-01-242
1530332Need to change the Version Number for UK16.04 in the page of "About This Computer"ubuntukylin-default-settingsshuilupi@ubuntukylin.com2016-01-112016-03-2473
1529454dm-tool add-nested-seat failslightdmrobert.ancell@canonical.com2015-12-272016-01-2529
1537395ubuntu-mate-welcome does not install virtualbox -- unmet dependenciiesubuntu-mate-welcomecode@flexion.org2016-01-232016-01-252
1537476ubuntu-mate-welcome 16.04.1 new release [debdiff attached]ubuntu-mate-welcomecode@flexion.org2016-01-242016-01-251
1537567Please update ubuntu-mate-meta for 16.04 Alpha 2ubuntu-mate-metatimo-jyrinki@ubuntu.com2016-01-242016-01-251
1535163Please upload shimmer-themes-2.1.0-0ubuntu1 to xenialshimmer-themessmd.seandavis@gmail.com2016-01-182016-01-257
1513241libsdl2 No longer works with MIR 0.14 and greater (ABI/API break)libsdl2brandontschaefer@gmail.com2015-11-042016-01-2582
1537789MAAS dhcp fails to start on up-to-date Xenial with MAAS built from sourceisc-dhcplamont@canonical.com2016-01-252016-01-250
1535271nova-compute upstart configuration should not try to load nbd when running in a containernovacorey.bryant@canonical.com2016-01-182016-02-0114
1536516Ubuntu14.04.04 Power NV system : rtas_errd flashing wrong infoppc64-diagsteve.langasek@ubuntu.com2016-01-212016-01-265
1524879initramfs-tools, Xenial is missing NVME kernel driverinitramfs-toolsapw@ubuntu.com2015-12-102016-01-2647
1532146update-initramfs fails for MODULES=dep when root is on nvme deviceinitramfs-toolsapw@ubuntu.com2016-01-082016-01-2618
1537211clean up /var/log/udev.logapportmartin.pitt@ubuntu.com2016-01-262016-01-260
932274Regression: Unreadable menu bar with Ambiance theme in Java/Swing GTK L&Fopenjdk-6doko@ubuntu.com2012-07-072016-02-011304
1538198python in xenial cloud imagevimdoko@ubuntu.com2016-01-262016-02-2025
1538165Security Issues Impacting NGINX: 1.8.x, 1.9.xnginxteward@ubuntu.com2016-01-262016-01-260
1531779/usr/lib/ubiquity/bin/ubiquity:ValueError::start:prepare:is_secure_bootubiquitymathieu-tl@ubuntu.com2016-01-072016-01-2720
1538385Add libpam-cgfs packagelxcfsserge.hallyn@ubuntu.com2016-01-272016-01-281
1522346Please merge nut 2.7.2-4 (main) from debian (unstable)nutlouis.bouchard@ubuntu.com2015-12-032016-01-2856
1538520openafs: needs porting to mainline v4.4openafsapw@ubuntu.com2016-01-272016-01-270
1538475Dekko can't open webviews on a Xenial (+Unity8) laptopapparmor-easyprof-ubuntujamie@ubuntu.com2016-01-272016-01-270
1403293Unity Dash can't understand "logout", "reboot", or "shutdown"session-shortcutsmcintire.evan@gmail.com2014-12-172016-01-28407
1538610ppc64el xenial cloud images do not boot in kvmlivecd-rootfsdaniel.watkins@canonical.com2016-01-272016-01-270
1480513nginx-common should not depend on pythonnginxteward@ubuntu.com2015-08-012016-01-27179
1538677Please merge 1.9.10-1 (main) from Debian Unstable (main)nginxteward@ubuntu.com2016-01-272016-01-270
1527710apt-get update triggers asynchronous taskupdate-notifiersmoser@ubuntu.com2015-12-182016-01-2740
1535318deprecation of python-supportlernidJohnSGruber@gmail.com2016-01-182016-02-0417
1515446network file systems in FSTAB no longer mount at boot with NetworkManagernetwork-managerbryan.quigley@canonical.com2015-11-122016-01-2877
1089013clvm startup script requires cmanlvm2billy.olsen@canonical.com2012-12-112016-01-291144
1539016Remove /bin/running-in-containerqemumartin.pitt@ubuntu.com2016-01-282016-02-014
1398274[Feature] TPM2.0 kernel supportlinuxapw@canonical.com2016-01-272016-04-0872
1446906lxc container with postfix, permission denied on mailqlinuxapw@canonical.com2016-01-262016-02-016
1461360[Feature]Knights Landing PMU (Performance Monitoring Unit) supportlinuxapw@canonical.com2016-01-272016-02-015
1506521[Hyper-V] hv_set_ifconfig issues on Wily 15.10linuxapw@canonical.com2015-10-152016-02-01109
1520457Telemetry Enabling for Broxton-Plinuxapw@canonical.com2016-01-272016-02-015
1527462[Feature]Skylake GT4e supportlinuxapw@canonical.com2016-01-272016-02-015
1529381[HP Compaq 6715s] Updating kernel renders system unbootablelinuxapw@canonical.com2015-12-262016-02-0137
1533035[BugFix] Skylake intel-lpss fix linuxapw@canonical.com2016-01-272016-02-015
1534647Collateral damage due to kernel configuration change enabling CONFIG_ZONE_DEVICE (Kernel 4.4 amd64)linuxapw@canonical.com2016-01-152016-02-1834
1536473[Feature] Update ixgbe and ixgbevf driver in 16.04linuxapw@canonical.com2016-01-252016-02-017
1536474[Feature] Update i40e and i40evf driver in 16.04linuxapw@canonical.com2016-01-222016-02-0110
1536475[Feature] Update fm10k driver in 16.04linuxapw@canonical.com2016-01-252016-02-017
1536719Update bnx2x firmware for Linux 4.4 to 7.12.30.0linuxapw@canonical.com2016-01-212016-02-0111
1537881[Ubuntu 16.04] Better handling of hypervisor maintenance interruptslinuxapw@canonical.com2016-01-252016-02-017
1537923Add pvpanic driver to Ubuntu 15.10 virtual kernellinuxapw@canonical.com2016-01-252016-02-017
1538618flashcache: build failures against kernel 4.4linuxapw@canonical.com2016-01-272016-02-015
1539090linux: 4.4.0-2.16 -proposed trackerlinuxapw@canonical.com2016-01-282016-02-014
1535634linux-signed: does not build in a private PPAlinux-signedapw@canonical.com2016-01-192016-02-0113
74747Default sources.list file has source packages enabled by defaultapt-setupxnox@ubuntu.com2006-12-072016-01-293340
1533004Please consider upgrade to the latest upstream (1.3.2+)virt-managermarc.deslauriers@ubuntu.com2016-01-122016-01-2917
1306065main.log doesn't always report right version of python-aptubuntu-release-upgraderbrian@ubuntu.com2014-04-102016-02-01662
1538880Using DistUpgradeViewNonInteractive causes output to be garbled.ubuntu-release-upgraderbrian@ubuntu.com2016-01-282016-02-014
1539338Mir fails to build on xenial today: android_graphic_buffer_allocator.h:23:31: fatal error: hardware/hardware.h: No such file or directoryandroid-headersraof@ubuntu.com2016-01-292016-01-290
1539063flashcache: need to merge with debian unstableflashcacheapw@ubuntu.com2016-01-282016-01-291
1536563Sync python-greenlet 0.4.9-1 (main) from Debian unstable (main)python-greenletlocutusofborg@debian.org2016-01-212016-01-298
1539774/usr/lib/lbdb/mutt_ldap_query throws deprecated warnings lbdbchris.j.arges@canonical.com2016-01-292016-01-290
1539544[Ubuntu 16.04] ppc64-diag package update2ppc64-diagsteve.langasek@ubuntu.com2016-01-292016-01-290
1432062multipath-tools-boot: support booting without user_friendly_names on devices with spaces in identifiersmultipath-toolsmathieu-tl@ubuntu.com2015-03-132016-01-30323
1526984ISST-LTE: root mpath device unavailable after installationmultipath-toolsmathieu-tl@ubuntu.com2015-12-162016-01-3045
1533893fix tests on s390xmysql-5.6xnox@ubuntu.com2016-01-132016-01-3017
1540268fonts-ipaexfont-mincho package provides incorrect aliasfonts-ipaexfontnobuto@ubuntu.com2016-02-012016-02-010
1539845Enable raw image supportgegltim@feathertop.org2016-01-302016-02-012
1539699please merge libgpod from debianlibgpodlocutusofborg@debian.org2016-01-292016-02-013
1518053xdg-mime can read .config/ defaults but can never set themxdg-utilschad.miller@canonical.com2015-11-192016-02-0174
1430557sbuild / schroot unmounted encrypted home directoryschrootmartin.pitt@ubuntu.com2015-03-102016-02-01328
1509414pre-installed lxc in cloud image produces broken lxc (and later lxd) containerslxcstgraber@ubuntu.com2015-10-232015-10-263
1530894.mo files don't seem to be allowed in packages of arch 'all'click-reviewers-toolsjamie@ubuntu.com2016-01-042016-02-2249
1067779missing pam_loginuid.so breaks getlogin()shadowsteve.langasek@ubuntu.com2013-05-222016-02-03987
1304505Guest session not workingshadowsteve.langasek@ubuntu.com2014-04-082016-02-03666
1348873"remove" spelled as "remvoe" in "usermod -h"shadowsteve.langasek@ubuntu.com2014-07-262016-02-02556
1368864old motd is displayed on loginshadowsteve.langasek@ubuntu.com2014-09-122016-02-03509
1540660kpartx fails to add device mappingsmultipath-toolsmathieu-tl@ubuntu.com2016-02-012016-02-021
1540004Update to 3.3rhythmboxtim@feathertop.org2016-01-302016-02-023
1525402"Input Sources" button looks really out of place in Keyboard settingsgnome-control-centertim@feathertop.org2015-12-112016-02-0354
1454725openvpn no longer called with "--script-security 2"openvpnmartin.pitt@ubuntu.com2015-05-132016-02-02265
1540921package adwaita-icon-theme 3.18.0-2ubuntu1 failed to install/upgrade: intentando sobreescribir `/usr/share/icons/Adwaita/256x256/status/security-low.png', que está también en el paquete adwaita-icon-theme-full 3.18.0-2ubuntu1adwaita-icon-themeiain@orangesquash.org.uk2016-02-022016-02-020
1539719dbginfo.sh needs to be included in s390-toolss390-toolsxnox@ubuntu.com2016-01-292016-02-0911
1539727[Debian #813033] s390-netdevice/qeth: ask for relative OSA port numbers390-netdevicexnox@ubuntu.com2016-01-292016-02-024
1540058removing libpam-cgfs tries to remove cgm configlxcfsserge.hallyn@ubuntu.com2016-01-312016-02-022
1529624Lenovo E50-80 inverted microphone not detected properlylinuxtim.gardner@canonical.com2015-12-282016-02-1044
1531539[Ubuntu 16.04] Enable nvme block driver on Powerlinuxtim.gardner@canonical.com2016-01-062016-02-1035
1533461No headset microphone is detected in sound settings on a Dell laptoplinuxtim.gardner@canonical.com2016-01-132016-02-0624
1536810kernel install failed /bin/cp: cannot stat ‘/boot/initrd.img-4.3.0-7-generic’: No such file or directorylinuxtim.gardner@canonical.com2016-01-212016-02-2636
1538909OPRASHB:Habanero:EEH: Opal not calling out slot number for failing adapter behind plx switchlinuxtim.gardner@canonical.com2016-01-282016-02-1013
1539102EPOW related RTAS event messages in kernel logslinuxtim.gardner@canonical.com2016-01-282016-02-1013
1539349sleep from invalid context in aa_move_mountlinuxtim.gardner@canonical.com2016-01-292016-02-1012
1541058linux: 4.4.0-4.19 -proposed trackerlinuxtim.gardner@canonical.com2016-02-022016-02-108
1540933/var/lib/lightdm not created by defaultlightdmrobert.ancell@canonical.com2016-02-022016-02-031
1532213Run the tests in xenialsnapcraftsergio.schvezov@canonical.com2016-01-082016-02-0326
1537580Update version in setup.pysnapcraftsergio.schvezov@canonical.com2016-01-252016-02-039
1538016Integrate debug information from app dev manual.snapcraftsergio.schvezov@canonical.com2016-01-262016-02-038
1538354Poor information on tests errorssnapcraftsergio.schvezov@canonical.com2016-01-272016-02-037
1538643Examples tests are generating an empty coverage filesnapcraftsergio.schvezov@canonical.com2016-01-272016-02-037
1538657Support uploading snaps to the storesnapcraftsergio.schvezov@canonical.com2016-01-272016-02-037
1538688Support referencing the stage dir from snapcraft.yamlsnapcraftsergio.schvezov@canonical.com2016-01-272016-02-037
1538692Clean up messages for uploadssnapcraftsergio.schvezov@canonical.com2016-01-272016-02-037
1539122Skills and specifically the migration-skill needs to be supported in snapcraftsnapcraftsergio.schvezov@canonical.com2016-01-282016-02-036
1539139example autopkgtests fail with fatal: unable to connect to github.com:snapcraftsergio.schvezov@canonical.com2016-01-282016-02-036
1539146snapcraft dependencies are too bigsnapcraftsergio.schvezov@canonical.com2016-01-282016-02-036
1539196AttributeError: 'TestSnapcraftExamples' object has no attribute 'addDetail'snapcraftsergio.schvezov@canonical.com2016-01-282016-02-036
1539199Missing Build-Dependecy in debian/control: python3-responsessnapcraftsergio.schvezov@canonical.com2016-01-282016-02-036
1539208snapcraft login fails if account does not require two factor authenticationsnapcraftsergio.schvezov@canonical.com2016-01-282016-02-036
1539234Documentation is lacking an example of how to use snapcraft upload.snapcraftsergio.schvezov@canonical.com2016-01-282016-02-036
1539502Shorten Snapcraft article titlessnapcraftsergio.schvezov@canonical.com2016-01-292016-02-035
1539540Add links between articlessnapcraftsergio.schvezov@canonical.com2016-01-292016-02-035
1539814Upload not closing resource correctlysnapcraftsergio.schvezov@canonical.com2016-01-302016-02-034
1539817Unit tests are leaking messagessnapcraftsergio.schvezov@canonical.com2016-01-302016-02-034
1321257Rename neutron-plugin-openvswitch-agent to neutron-openvswitch-agent to avoid confusionneutroncorey.bryant@canonical.com2014-05-202016-02-22643
1539826initramfs-tools hook-functions error causes failureinitramfs-toolsapw@ubuntu.com2016-01-302016-02-034
1526808installed system qeth NIC name is too verbosesystemdmartin.pitt@ubuntu.com2015-12-162016-02-0248
1532553/etc/halt.local has become /usr/sbin/halt.localsystemdmartin.pitt@ubuntu.com2016-01-102016-02-0324
1539483Please merge rsyslog 8.16.0-1 (main) from Debian unstable (main)rsysloglouis.bouchard@ubuntu.com2016-01-292016-02-035
1541407/usr/share/apt-xapian-index/update-apt-xapian-index-dbus:SyntaxErrorapt-xapian-indexbarry@ubuntu.com2016-02-032016-02-030
1541332Missing build-packages in integration testssnapcraftsergio.schvezov@canonical.com2016-02-032016-02-030
1541349Should maybe depend on python3-requests-toolbelt?snapcraftsergio.schvezov@canonical.com2016-02-032016-02-030
1507490gedit crashed with SIGSEGV in gtk_text_iter_make_real()geditseb128@ubuntu.com2015-10-192016-02-03107
1523908/usr/bin/gedit:11:gedit_status_menu_button_set_label:language_changed:g_cclosure_marshal_VOID__PARAM:g_closure_invoke:signal_emit_unlocked_Rgeditseb128@ubuntu.com2015-12-082016-02-0357
1519778Single click opening of selected items in file-selector is confusinggtk+3.0seb128@ubuntu.com2015-11-252016-02-0471
1540896Always load all the nvidia modulesnvidia-graphics-drivers-340alberto.milone@canonical.com2016-02-022016-02-031
1531928[Xenial] root=PARTUUID= is not recognized as valid syntax.initramfs-toolsapw@ubuntu.com2016-01-072016-02-0428
1541508initramfs-tools: merge debian v0.122initramfs-toolsapw@ubuntu.com2016-02-032016-02-041
1376268Implement a touch editing UIoxide-qtchris.coulson@canonical.com2015-11-152016-03-11117
1441465Add Camera implementation for phoneoxide-qtchris.coulson@canonical.com2015-11-262016-01-1954
1508972Can't enumerate cameras on the phoneoxide-qtchris.coulson@canonical.com2015-11-262016-01-1954
1540153NetworkManager crashed with SIGSEGVnetwork-managerdidrocks@ubuntu.com2016-01-312016-02-033
1541775wrong /run/lock permissionssystemdmartin.pitt@ubuntu.com2016-02-042016-02-040
1541510parted crashes on lvm, on a dasd drivepartedxnox@ubuntu.com2016-02-032016-02-041
1524721Middle-clicking in unity trash or device icons doesn't open a new windownautilusseb128@ubuntu.com2015-12-102016-02-0557
1541954Revert to the previous nautilus versionnautilusseb128@ubuntu.com2016-02-042016-02-051
1512188Update request: skiboot 5.1.9 for OpenPower machinesskibootsteve.langasek@ubuntu.com2015-11-022016-02-0494
1541979pciutils: merge with debian 1:3.3.1-1.1pciutilsapw@ubuntu.com2016-02-042016-02-051
1541532migrate UTC setting from /etc/default/rcS to adjtimeinstallation-guidemartin.pitt@ubuntu.com2016-02-042016-02-040
1540965Support Joyent lx-brand environment in smartos datasourcecloud-initsmoser@ubuntu.com2016-02-022016-02-042
1514377Mouse mode broken with tmux 2.1byobukirkland@ubuntu.com2015-11-092016-04-08151
1507798libpam-sshauth dropped support for publickey authenticationlibpam-sshautheric.desrochers@canonical.com2015-10-192016-02-05109
1508597Build with multiarch supportmetacitydoko@ubuntu.com2015-10-212016-02-05107
1508588Build with multiarch supportbraserodoko@ubuntu.com2015-10-212016-02-05107
1541074cannot register s390x machinelandscape-clientxnox@ubuntu.com2016-02-022016-02-053
1508599Build with multiarch supportrhythmboxdoko@ubuntu.com2015-10-212016-02-05107
1541120[Hyper-V] PCI Passthrough prerequisiteslinuxapw@canonical.com2016-02-022016-02-108
1541326WARNING: at /build/linux-lts-wily-W0lTWH/linux-lts-wily-4.2.0/net/core/skbuff.c:4174 (Travis IB)linuxapw@canonical.com2016-02-032016-02-107
1541456[Ubuntu 16.04] Update qla2xxx driver for POWER (QLogic)linuxapw@canonical.com2016-02-032016-03-0834
1541592The lpfc driver is at rev 11.0.0.0 and needs to be at 11.0.0.10linuxapw@canonical.com2016-02-032016-02-107
1541671backport Microsoft Precision Touchpad palm rejection patchlinuxapw@canonical.com2016-02-042016-02-106
1542049lxc: ADT exercise test failing with linux-4.4.0-3.17 linuxapw@canonical.com2016-02-042016-02-106
1542296update ZFS and SPL to 0.6.5.4linuxapw@canonical.com2016-02-052016-02-105
1542535linux-raspi2: 4.4.0-1000.1 -proposed trackerlinux-raspi2tim.gardner@canonical.com2016-02-052016-03-0832
1542744Merge from debian 3.18.3-3gnome-shellnoskcaj@ubuntu.com2016-02-072016-02-070
1330009black square regression with wine 1.6wine1.6marc.deslauriers@ubuntu.com2014-06-142016-02-07603
1542747Empathy stop working with accounts setup with GOA after last telepathy updatetelepathy-mission-control-5doko@ubuntu.com2016-02-072016-02-081
1543051New helpers version fail on "unknown initscript"init-system-helpersmartin.pitt@ubuntu.com2016-02-082016-02-091
1541660please upload go 1.6 rc2golangmichael.hudson@canonical.com2016-02-042016-02-084
1540811[GDK] patch - avoid integer overflow when allocating a large block of memorygtk+2.0monsta@inbox.ru2016-02-022016-02-108
1540522vfat support broken in initramfsinitramfs-toolssmoser@ubuntu.com2016-02-082016-02-091
1543244initramfs-tools: initramfs-tools-core should depend on initramfs-tools-bininitramfs-toolsapw@ubuntu.com2016-02-082016-02-091
1543359New upstream release of 2.1.3walinuxagentben.howard@ubuntu.com2016-02-082016-02-091
1536664Installer cannot use DASD if it was used with LVM beforelvm2xnox@ubuntu.com2016-01-212016-02-1020
1536649Installer can not handle more than 60 OSA devices (triples)s390-netdevicexnox@ubuntu.com2016-01-232016-02-0917
1542338Request package upgrade of s390-tools to 1.33.0s390-toolsxnox@ubuntu.com2016-02-052016-02-094
1540425install/ziomon: include FCP performance monitoring utilities in s390-toolss390-toolsxnox@ubuntu.com2016-02-012016-02-098
1527328partman-auto lacks default guided partitioning recipes for s390xpartman-partitioningxnox@ubuntu.com2015-12-172016-02-1055
1534629Installer fails to format DASD during installation using Guided Setup methodspartman-partitioningxnox@ubuntu.com2016-01-152016-02-1026
1537942 zipl-installer fails on z/KVM installationpartman-partitioningxnox@ubuntu.com2016-01-252016-02-1016
1541925Tries to create temp files under ~/.gnupg but doesn't create the dirgnupgmarc.deslauriers@ubuntu.com2016-02-042016-02-106
1543430kpartx 0.5.0-7ubuntu11 fails to remove loop mapping on kpartx -dmultipath-toolsmathieu-tl@ubuntu.com2016-02-092016-02-101
1543636makedumpfile: Enable s390x buildsmakedumpfilexnox@ubuntu.com2016-02-092016-02-101
1543982dsdp tests hang on s390x when package is built with -O3dsdpdoko@ubuntu.com2016-02-102016-04-1565
1518235youtube-dl is outdatedyoutube-dlnoskcaj@ubuntu.com2015-11-202016-02-1082
1501634GnuPG 1.4/2.0 requires a patch for GCC 5gnupg2marc.deslauriers@ubuntu.com2015-10-012016-02-15137
1542276zfs-linux should run dh_systemd_start after installzfs-linuxcolin.king@canonical.com2016-02-052016-02-1914
1526548grep 2.22 infinite loopgrepdoko@ubuntu.com2015-12-152016-02-1057
1544108grep's test long-pattern-perf fails on powerpc when built with optimizationgrepdoko@ubuntu.com2016-02-102016-02-100
1527612$SNAP_APP_USER_DATA_PATH points to non-existing directory for servicesubuntu-core-launcherjamie@ubuntu.com2016-01-152016-02-1026
1512326Running apt-check --package-names returns an unknown errorupdate-notifierbrian@ubuntu.com2015-11-022016-02-10100
1524663Issues while validating snapcraft.yaml: None is not of type 'string'snapcraftsergio.schvezov@ubuntu.com2015-12-102016-02-1163
1533395Use docopt to handle example tests argumentssnapcraftsergio.schvezov@ubuntu.com2016-01-122016-02-1130
1541353'snapcraft upload' says 'Invalid package filename.'snapcraftsergio.schvezov@ubuntu.com2016-02-032016-02-118
1541391Missing integration tests for login/logout/uploadsnapcraftsergio.schvezov@ubuntu.com2016-02-032016-02-118
1541404Integrate https://developer.ubuntu.com/snappy/guides/mir-snaps/ into docs/snapcraftsergio.schvezov@ubuntu.com2016-02-032016-02-129
1541421Run unittests as part of the integration testssnapcraftsergio.schvezov@ubuntu.com2016-02-032016-02-118
1541894apt runs update-motd-updates-availablesnapcraftsergio.schvezov@ubuntu.com2016-02-042016-02-117
1542422Move image into docs/imagessnapcraftsergio.schvezov@ubuntu.com2016-02-052016-02-116
1542479Support an output option for the snap commandsnapcraftsergio.schvezov@ubuntu.com2016-02-052016-02-116
1542511Fix adt testssnapcraftsergio.schvezov@ubuntu.com2016-02-052016-02-116
1543581Document wrapper scriptsnapcraftsergio.schvezov@ubuntu.com2016-02-092016-02-112
1543596Briefly explain the filesystem layoutsnapcraftsergio.schvezov@ubuntu.com2016-02-092016-02-112
1543675The coveralls token is not needed for the travis executionssnapcraftsergio.schvezov@ubuntu.com2016-02-092016-02-123
1543714examples tests fail with UnicodeDecodeErrorsnapcraftsergio.schvezov@ubuntu.com2016-02-092016-02-123
1543144systemd: adt test failures againt Ubuntu-4.4.0-4.19 -- systemd-fsckd failingsystemdmartin.pitt@ubuntu.com2016-02-082016-02-113
1543282masked jobs trigger warning about failed dependencysystemdmartin.pitt@ubuntu.com2016-02-082016-02-113
1533200Black background at first loginxubuntu-default-settingssmd.seandavis@gmail.com2016-01-122016-02-1130
1535500Enable OpenGL 4.1 with radeonsi driver on xenialmesatjaalton@debian.org2016-01-192016-02-1527
1540282Breaks policykit/systemctl commands when restarteddbusmartin.pitt@ubuntu.com2016-02-012016-02-1110
1479652[patch] ntpd rejects source UDP ports less than 123 as bogusntppierre-andre.morey@canonical.com2015-07-302016-02-17202
1512980Please enable PPS in the Ubuntu build of ntpdntppierre-andre.morey@canonical.com2015-11-042016-02-17105
1544487Please update bzr to 2.7.0bzrv.ladeuil+lp@free.fr2016-02-112016-02-176
1543399php-directory-scanner: add nocheck and stage1 build profilesphp-directory-scannernish.aravamudan@canonical.com2016-02-092016-02-112
1505564Soft lockup with "block nbdX: Attempted send on closed socket" spamlinuxapw@canonical.com2015-10-132016-02-18128
1521678perf enahancements for ppc64linuxapw@canonical.com2015-12-012016-02-1879
1540435Introducing ConnectX-4 Ethernet SRIOVlinuxapw@canonical.com2016-02-012016-02-1817
1541534s390/cio: update measurement characteristicslinuxapw@canonical.com2016-02-032016-02-1815
1541907qeth: layer2 reports unknown state to network tools.linuxapw@canonical.com2016-02-042016-02-1814
1542728virtualbox: update to 5.0.14-dfsg-2linuxapw@canonical.com2016-02-062016-02-1812
1542771make wacom_w8001 work well in xeniallinuxapw@canonical.com2016-02-072016-02-1811
1544637linux: 4.4.0-5.20 -proposed trackerlinuxapw@canonical.com2016-02-112016-02-187
1544471Install failure: trying to overwrite '/usr/share/dbus-1/services/org.freedesktop.PackageKit.service', which is also in package gnome-packagekit-session 3.14.2-0ubuntu2gnome-softwarerobert.ancell@canonical.com2016-02-112016-02-110
1541451Python2 plugin uses pyversions without installing itsnapcraftsergio.schvezov@ubuntu.com2016-02-032016-02-129
1544340tests depend on dpkg-architecturesnapcraftsergio.schvezov@ubuntu.com2016-02-102016-02-122
1544343Test assets missing libc6-devsnapcraftsergio.schvezov@ubuntu.com2016-02-102016-02-122
1544347Example missing build-dependssnapcraftsergio.schvezov@ubuntu.com2016-02-102016-02-122
1544558All apps are marked as 3rd party non-freegnome-softwarerobert.ancell@canonical.com2016-02-112016-02-110
1544776package click 0.4.42+16.04.20151229-0ubuntu1 failed to install/upgrade: subprocess installed pre-removal script returned error exit status 1clickcjwatson@ubuntu.com2016-02-112016-02-121
1544790ros example fails to snapsnapcraftsergio.schvezov@ubuntu.com2016-02-122016-02-131
1544792integration test using after missing build dependssnapcraftsergio.schvezov@ubuntu.com2016-02-122016-02-120
1545010FTBFS on s390xperftestdannf@ubuntu.com2016-02-122016-02-120
1526127node install error Unexpected error command: ['curtin', 'block-meta', 'simple']curtinsmoser@ubuntu.com2015-12-172016-02-1257
1532062Drives mistakenly reported as removablecurtinsmoser@ubuntu.com2016-01-082016-02-1235
1292335do-release-upgrade crashed with AttributeError in run(): 'apt_pkg.PackageManager' object has no attribute 'ResultFailed'ubuntu-release-upgraderbrian@ubuntu.com2014-03-142016-02-17705
1543349upgrade php-memcache for PHP7.0php-memcachesteve.langasek@ubuntu.com2016-02-082016-02-2214
1543376phpab: add nocheck and stage1 build profilesphpabnish.aravamudan@canonical.com2016-02-092016-02-145
1543710php-codesniffer: add nocheck and stage1 build profilesphp-codesniffernish.aravamudan@canonical.com2016-02-092016-02-145
1445064Re-implement container crash forwardingapportmartin.pitt@ubuntu.com2015-04-162016-02-15305
1545750Access denied if the share path is "/"sambadariusz.gadomski@canonical.com2016-02-152016-02-161
1542028xapp window should reflect app name rather than "Xmir root window"xorg-serverrobert.ancell@canonical.com2016-02-042016-02-1612
1540491Please merge clamav 0.99+dfsg-1 (main) from Debian stableclamavlouis.bouchard@ubuntu.com2016-02-012016-02-1716
1544647postinst syntax error, if condition without "then", and directory path error (Ceph 9.2.0 only)cephjames.page@ubuntu.com2016-02-112016-02-176
1544574partman: mkfs.xfs: error - cannot set blocksize 512 on block device /dev/dasda1: Invalid argumentxfsprogsxnox@ubuntu.com2016-02-112016-02-165
1545785bzrtools blocking bzr-2.7.0 promotionbzrtoolsv.ladeuil+lp@free.fr2016-02-152016-02-161
1545787 bzr-pipeline blocking bzr-2.7.0 promotionbzr-pipelinev.ladeuil+lp@free.fr2016-02-152016-02-161
1542758Missing Ubuntu-specific build-dep: libunity-devnitroshareteward@ubuntu.com2016-02-072016-02-169
1542242Search doesnt return any resultsappstream-glibiain.lane@canonical.com2016-02-112016-02-165
1545786error trying to execute snap binaryubuntu-core-launcherjamie@ubuntu.com2016-02-162016-02-193
1495983[Hyper-V] kernel panic occurs when installing Ubuntu Server x32linuxtim.gardner@canonical.com2015-09-152016-02-18156
1542071 Naples/Zen, NTB Driver linuxtim.gardner@canonical.com2016-02-162016-02-182
1545037Surelock-GA2:kernel panic/ exception @ pcibios_set_pcie_reset_state+0x118/0x280 + cxl_reset+0x5c/0xc0linuxtim.gardner@canonical.com2016-02-122016-02-186
1545542Enable arm64 emulation of removed ARMv7 instructionslinuxtim.gardner@canonical.com2016-02-152016-02-183
1546283linux: 4.4.0-6.21 -proposed trackerlinuxtim.gardner@canonical.com2016-02-162016-02-182
1526931upgrade 14.04->16.04 doesn't replace linux-generic-lts-wily with linux-genericlinux-metatim.gardner@canonical.com2015-12-162016-02-1864
1546404Merge libvoikko 4.0.1-3 (main) from Debian unstable (main)libvoikkotimo-jyrinki@ubuntu.com2016-02-172016-02-170
1546112ceph fails to uninstallcephjames.page@ubuntu.com2016-02-162016-02-171
1546482logerhead blocking bzr-2.7.0 promotionloggerheadv.ladeuil+lp@free.fr2016-02-172016-02-170
1541917kmod: merge debian 22-1kmodapw@ubuntu.com2016-02-042016-02-2521
1544100Request package for libdfplibdfpxnox@ubuntu.com2016-02-102016-02-177
1390767trying to overwrite shared '/usr/share/man/man1/freetype-config.1.gz', which is different from other instances of package libfreetype6-dev:i386freetypemarc.deslauriers@ubuntu.com2014-11-082016-02-17466
1521289DPDK with Xendpdkchristian.ehrhardt@canonical.com2015-11-302016-02-2284
1475021[MIR] gcabgcabmario_limonciello@dell.com2015-07-152016-02-17217
1546606Unable to install Ubuntu 16.04 on Tuleta with multipath setuphw-detectmauricfo@linux.vnet.ibm.com2016-02-172016-02-225
1544565Two results for 'gedit'gnome-softwarerobert.ancell@canonical.com2016-02-112016-02-198
1440504libpeas-1.0-0 depends on both libpython2.7 and libpython3.4gtranslatorbarry@ubuntu.com2016-02-162016-02-182
1544376[ffe] Enable firmware supportappstream-glibmario_limonciello@dell.com2016-02-112016-02-187
1309594kernel-libipsec not loadingstrongswanryan.harper@canonical.com2014-04-182016-02-18671
1330504strongSwan 5.1.3strongswanryan.harper@canonical.com2014-06-162016-02-18612
1333655strongSwan AppArmor profile does not allow user priv droppingstrongswanryan.harper@canonical.com2014-06-242016-02-18604
1448870Certificate policies cause rejectionsstrongswanryan.harper@canonical.com2015-04-272016-02-18297
1451091new upstream version 5.2.2strongswanryan.harper@canonical.com2015-05-022016-02-18292
1470277strongswan apparmor profile doesn't permit xauth-pamstrongswanryan.harper@canonical.com2015-06-302016-02-18233
1505222strongSwan AppArmor prevents CRL cachingstrongswanryan.harper@canonical.com2015-10-122016-02-18129
1545884Xenial's shadow regresses subid allocation logic (wastes uids and gids)shadowserge.hallyn@ubuntu.com2016-02-162016-02-182
448503Improvement: Add comment to ruleufwjamie@ubuntu.com2009-10-112016-02-182321
728128ufw user.rules should be stored in /etcufwjamie@ubuntu.com2011-03-022016-02-181814
1546877sync with debian testing (2.0.873+git0.3b4b4500-13)open-iscsismoser@ubuntu.com2016-02-182016-03-0213
1543324[needs-packaging] php-pearphp-pearsteve.langasek@ubuntu.com2016-02-082016-03-0930
1412647contradictory COPYRIGHT informationonboardfrancesco.fumanti@gmx.net2015-01-202016-02-25401
1513773Accentuated chars are not visualy modified by CAPS-LOCKonboardfrancesco.fumanti@gmx.net2015-11-062016-02-19105
1529140click sound strange behaviour, fades to nothing based on mouse positiononboardfrancesco.fumanti@gmx.net2015-12-242016-02-1957
1530519make build reproducibleonboardfrancesco.fumanti@gmx.net2016-01-022016-02-1948
1532254Onboard/workspace switcheronboardfrancesco.fumanti@gmx.net2016-01-082016-02-1942
1534210The Small layout for Onboard is missing russian letter Ж (je)onboardfrancesco.fumanti@gmx.net2016-01-142016-02-1835
1547054Request for sponsorship for new upstream release (xenial deb provided)onboardfrancesco.fumanti@gmx.net2016-02-182016-02-180
1520436[Feature]Pulse-Width Modulation enabling on Broxton-Plinuxtim.gardner@canonical.com2016-02-172016-02-236
1540586[Hyper-V] Netmask value is not parsed by hv_set_ifconfig - IP injectionlinuxtim.gardner@canonical.com2016-02-012016-02-2322
1544321In A Single Power VM LPAR : Network Configuration Fails in Ubuntu16.04 while installationlinuxtim.gardner@canonical.com2016-02-102016-02-2313
1544679Request to merge upstream fixes into 16.04 for megaraid driverlinuxtim.gardner@canonical.com2016-02-112016-02-2312
1546145Surelock-GA2:kernel panic @ cxl_configure_adapter+0x418/0x8b0linuxtim.gardner@canonical.com2016-02-162016-02-237
1546775Please pull cgroup namespaceslinuxtim.gardner@canonical.com2016-02-172016-02-236
1547047need arm64 acpi parking protocol support in xeniallinuxtim.gardner@canonical.com2016-02-182016-02-235
1547205linux: 4.4.0-7.22 -proposed trackerlinuxtim.gardner@canonical.com2016-02-182016-02-235
1546455Many instances of 'apparmor="DENIED" operation="create" profile="/usr/sbin/ntpd" pid=15139 comm="ntpd" family="unspec" sock_type="dgram" protocol=0' in syslogapparmortyhicks@canonical.com2016-02-172016-02-236
1547223linux-raspi2: 4.4.0-1001.2 -proposed trackerlinux-raspi2tim.gardner@canonical.com2016-02-182016-03-0819
1547245php7.0: remove dependencies that come from universephp7.0nish.aravamudan@canonical.com2016-02-182016-03-1223
1546799Sync fop 1:2.1-2 (main) from Debian unstable (main)xmlgraphics-commonsnish.aravamudan@canonical.com2016-02-182016-02-191
1539903tomcat-8 in main for upcoming 16.04 LTStomcat8nish.aravamudan@canonical.com2016-01-302016-02-1920
1546823swig: disable PHP bindings until PHP7 support existsswignish.aravamudan@canonical.com2016-02-182016-02-191
1544337php-doctrine-cache-bundle: update dependencies and add nocheck and stage1 build profilesphp-doctrine-cache-bundlenish.aravamudan@canonical.com2016-02-102016-02-2212
1544316doctrine: update to PHP 7.0 dependenciesdoctrinenish.aravamudan@canonical.com2016-02-102016-02-199
1544307phpunit: add PHP 7.0 dependenciesphpunitnish.aravamudan@canonical.com2016-02-102016-02-2111
1544304phpunit-mock-object: add nocheck and stage1 build profilesphpunit-mock-objectnish.aravamudan@canonical.com2016-02-102016-02-199
1543721php-email-validator: add nocheck and stage1 build profilesphp-email-validatornish.aravamudan@canonical.com2016-02-092016-02-1910
1543723libphp-swiftmailer: move to generic PHP dependencieslibphp-swiftmailernish.aravamudan@canonical.com2016-02-092016-02-1910
1543740upgrade to php-proxy-manager 2.0.0php-proxy-managernish.aravamudan@canonical.com2016-02-092016-03-1939
1543826php-monolog: bootstrap for PHP7.0php-monolognish.aravamudan@canonical.com2016-02-092016-03-1838
1543846phpunit-recursion-context: add nocheck and stage1 build profilesphpunit-recursion-contextnish.aravamudan@canonical.com2016-02-092016-02-1910
1543847phpunit-diff: add nocheck and stage1 build profilesphpunit-diffnish.aravamudan@canonical.com2016-02-092016-02-1910
1543848phpunit-environment: add nocheck and stage1 build profilesphpunit-environmentnish.aravamudan@canonical.com2016-02-092016-02-1910
1543849phpunit-exporter: add nocheck and stage1 build profilesphpunit-exporternish.aravamudan@canonical.com2016-02-092016-02-1910
1543851php-token-stream: add nocheck and stage1 build profilesphp-token-streamnish.aravamudan@canonical.com2016-02-092016-02-1910
1543852php-timer: add nocheck and stage1 build profilesphp-timernish.aravamudan@canonical.com2016-02-092016-02-1910
1543853php-doctrine-instantiator: add nocheck and stage1 build profilesphp-doctrine-instantiatornish.aravamudan@canonical.com2016-02-092016-02-1910
1543855php-doctrine-collections: add nocheck and stage1 build profilesphp-doctrine-collectionsnish.aravamudan@canonical.com2016-02-102016-02-199
1543856php-doctrine-inflector: add nocheck and stage1 build profilesphp-doctrine-inflectornish.aravamudan@canonical.com2016-02-102016-02-199
1543867php-xdebug: ensure segmentation fault fix is in Xenialxdebugnish.aravamudan@canonical.com2016-02-102016-02-199
1543868php-doctrine-cache: add nocheck and stage1 build profilesphp-doctrine-cachenish.aravamudan@canonical.com2016-02-102016-02-2414
1543869php-doctrine-common: add nocheck and stage1 build profilesphp-doctrine-commonnish.aravamudan@canonical.com2016-02-102016-02-199
1544303phpunit-comparator: add nocheck and stage1 build profilesphpunit-comparatornish.aravamudan@canonical.com2016-02-102016-02-199
1544279symfony: update and bootstrap for PHP7.0 supportsymfonynish.aravamudan@canonical.com2016-02-102016-02-2212
1544276twig: update and bootstrap for PHP7.0 supporttwignish.aravamudan@canonical.com2016-02-102016-03-0928
1541611Switch build to use VTE 2.91cairo-dock-plug-instim@feathertop.org2016-02-032016-02-1916
1547460openvswitch-switch-dpdk failing in autopkgtestsopenvswitch-dpdkchristian.ehrhardt@canonical.com2016-02-192016-02-223
1440564please use Python3 for all scriptsxdiagnosebarry@ubuntu.com2015-04-052016-02-19320
1537125ubuntu-14.04.04: fail to run systemtap test suiteselfutilsdoko@ubuntu.com2016-02-192016-02-245
1518516ubuntu session option "Show the menus for a window > In the windows title bar" loses menus in geditgeditseb128@ubuntu.com2015-11-212016-02-1990
1527592Can't switch workspaces by right-clicking in window title bargeditseb128@ubuntu.com2015-12-182016-02-1963
1542129gedit doubled close-maximize-minimize in 16.04geditseb128@ubuntu.com2016-02-052016-02-1914
1542633nautilus crashed with SIGSEGV in nautilus_drag_default_drop_action_for_icons()nautilusseb128@ubuntu.com2016-02-062016-02-2014
1547642Xenial default configuration refers to PHP5, not PHP7; uses incorrect default php-fpm socket path as wellnginxteward@ubuntu.com2016-02-192016-02-212
1547190LXD Power8 container hangs and slow creationlxdstgraber@ubuntu.com2016-02-182016-02-202
1547676GNOME Software Unity launcher integrationgnome-softwarerobert.ancell@canonical.com2016-02-192016-02-190
1547682Unable to load opendaylight mechanism drivernetworking-odljames.page@ubuntu.com2016-02-192016-02-190
1547845ibus-mozc install by defaultlanguage-selectorikuya@fruitsbasket.info2016-02-202016-02-200
1513922[xenial] backtrace gives python error on i386gdbdoko@ubuntu.com2015-11-062016-02-20106
1547989ubuntu-mate-settings 16.04.2 release [debdiff attached]ubuntu-mate-settingscode@flexion.org2016-02-212016-02-210
1548120[xenial][initramfs-tools] support uppercase and lowercase uuidsinitramfs-toolsapw@ubuntu.com2016-02-212016-03-0614
1544341php-doctrine-bundle: update and add nocheck and stage1 build profilesphp-doctrine-bundlenish.aravamudan@canonical.com2016-02-102016-02-2212
1545017dist-upgrading xenial hangs in lxd.postinstlxdstgraber@ubuntu.com2016-02-122016-02-2210
1547947ubuntu-mate-artwork 16.04.2 new release [debdiff and tarball attached]ubuntu-mate-artworkcode@flexion.org2016-02-202016-02-222
1547423"Assistant" type window UI components lack paddinggtk+3.0seb128@ubuntu.com2016-02-192016-02-234
1547510tracker for xorg-server 1.18 migrationgtk+3.0seb128@ubuntu.com2016-02-192016-02-234
958345ttf-indic-fonts packages are outdated should be removedlibreoffice-l10nbjoern.michaelsen@canonical.com2015-03-122016-02-22347
1389936LibreOffice has no support for Google Drivelibreoffice-l10nbjoern.michaelsen@canonical.com2014-11-062016-02-23474
1483914libreoffice-style-elementary as alternate to libreoffice-style-humanlibreoffice-l10nbjoern.michaelsen@canonical.com2015-08-112016-02-23196
1524638[MIR] ucpp for LibreOfficelibreoffice-l10nbjoern.michaelsen@canonical.com2015-12-102016-02-1668
1538822Please update to >= 3.4.1opencryptokixnox@ubuntu.com2016-01-282016-02-2427
1432265does not ask for LUKS passphrases without plymouthplymouthmartin.pitt@ubuntu.com2015-03-142016-02-22345
1514731OpenStack Installation Guide for Ubuntu in Installation Guide Executable not found: conntrack (filter match = conntrack)neutronjames.page@ubuntu.com2015-11-162016-02-2298
1527005Open vSwitch and Linux bridge agent dependenciesneutronjames.page@ubuntu.com2015-12-172016-02-2267
1548242neutron-plugin-openvswitch-agent init and upstart configurations not removed/missing transitional package.neutronjames.page@ubuntu.com2016-02-222016-02-220
1548244Rename neutron-plugin-linuxbridge-agent -> neutron-linuxbridge-agentneutronjames.page@ubuntu.com2016-02-222016-02-220
1548245Installing neutron-server results in neutron-openvswitch-agent being installedneutronjames.page@ubuntu.com2016-02-222016-02-220
1548133ubuntu-mate-welcome 16.04.3 new release [debdiff and tarball attached]ubuntu-mate-welcomecode@flexion.org2016-02-212016-02-221
1548334Please update ubuntu-mate-meta for 16.04 Beta 1ubuntu-mate-metadaniel.holbach@ubuntu.com2016-02-222016-02-220
1546911Please recompile sqlite 3.11 with -DSQLITE_ENABLE_FTS3_TOKENIZERsqlite3lukasz.zemczak@ubuntu.com2016-02-182016-02-235
1548440lxc: adt testing failing with 4.4.0-7.22lxdstgraber@ubuntu.com2016-02-222016-02-231
1546108Latest Vagrant box for Ubuntu Xenial is failing to bootlivecd-rootfsxnox@ubuntu.com2016-02-162016-03-1730
1548430kpatch: adt testing failing with 4.4.0-7.2kpatchchris.j.arges@canonical.com2016-02-222016-02-231
1547793upowerd crashed with SIGSEGV in g_variant_is_trusted()upowermartin.pitt@ubuntu.com2016-02-202016-02-233
1548477man seems to be using primitive 'more' rather than 'less'lesscjwatson@ubuntu.com2016-02-222016-02-231
794494fuse.conf permission deniedfusexnox@ubuntu.com2011-06-082016-02-231721
1529445Several memory/file descriptor leaks in gstreamer 1.6.0pidginseb128@ubuntu.com2015-12-272016-01-2731
1317153os-prober 90fallback - kernels detected out of orderos-proberxnox@ubuntu.com2014-05-072016-02-23657
1548883grilo CONTAINER_MAX_TRACKS is artificially too lowrhythmboxjamie@ubuntu.com2016-02-232016-02-241
1540401ISST-LTE: Ubuntu14.04.4 lpar fails to boot after installation: "The disk drive for /boot is not ready yet or not present"multipath-toolsmathieu-tl@ubuntu.com2016-02-012016-02-2322
1548975Unnecessary dependencies in the debian packagingecryptfs-utilskirkland@ubuntu.com2016-02-232016-02-230
1548888calendar app does not startapparmor-easyprof-ubuntujamie@ubuntu.com2016-02-232016-02-230
1548858Trusty → Xenial upgrade window vanishes with no crashubuntu-release-upgraderbrian@ubuntu.com2016-02-232016-02-241
1508611Build with multiarch supportlibpeasdoko@ubuntu.com2015-10-212016-02-24126
1548878lxc file push creates broken permissionslxdstgraber@ubuntu.com2016-02-232016-02-241
1549133upgrade failurelxdmartin.pitt@ubuntu.com2016-02-242016-02-240
1548972strcred.py is missing from packaging on Twisted 16/Xenialtwisteddoko@ubuntu.com2016-02-232016-02-241
1526264ntpdate fails with invalid argument when device is set to a date in the future (delta > 2^16)ntplukasz.zemczak@ubuntu.com2015-12-152016-02-2471
1539195adjust wait-for-root to deprecated udev APIinitramfs-toolsapw@ubuntu.com2016-01-282016-03-0638
1547956ubiquity crashed with dbus.exceptions.DBusException in call_blocking(): org.freedesktop.DBus.Error.InvalidArgs: No such interface '/org/freedesktop/UPower'ubiquitymartin.pitt@ubuntu.com2016-02-202016-02-244
1508590Build with multiarch supportevincedoko@ubuntu.com2015-10-212016-02-24126
1256822Misspelling in description of linux*-tools-*linux-goldfishapw@canonical.com2014-04-202016-02-24675
1271653[MIR] libiscsiqemujames.page@ubuntu.com2016-02-242016-02-251
1549136Move "lxc" dependencies to "lxc1"lxcstgraber@ubuntu.com2016-02-242016-02-251
1512221MPT3SAS Driver update for next kernel releaselinuxapw@canonical.com2015-11-022016-02-26116
1531747overlay: mkdir fails if directory exists in lowerdir in a user namespacelinuxapw@canonical.com2016-01-072016-02-2650
1534961insecure overlayfs xattrs handling in copy_uplinuxapw@canonical.com2016-01-162016-02-2641
1535150overlayfs over fuse should refuse copy_up of files if uid/gid not mappedlinuxapw@canonical.com2016-01-172016-02-2640
1547153/sys/class/scsi_host/hostN/partition_number and .../mad_version showing up BE on LE Ubuntu. (ibmvscsi)linuxapw@canonical.com2016-02-182016-02-268
1547674Update Intel ethernet drivers to Fortville SW5linuxapw@canonical.com2016-02-192016-02-267
15477184.4.0-7.22 no longer boots on arm64linuxapw@canonical.com2016-02-192016-02-267
1549398xenial master-next: cgroup mounting broken in containerslinuxapw@canonical.com2016-02-242016-02-262
1492186[MIR] dpdkopenvswitchjames.page@ubuntu.com2016-02-242016-02-251
1549389Cannot import twisted.conchtwisteddoko@ubuntu.com2016-02-242016-02-251
1549509details section icons (localised/documented/...) not changinggnome-softwarerobert.ancell@canonical.com2016-02-242016-02-251
1549500Updates' details window has "null" in its titlegnome-softwarerobert.ancell@canonical.com2016-02-242016-02-251
1549503Updates' details doesn't include changelog and other detailsgnome-softwarerobert.ancell@canonical.com2016-02-242016-02-251
1549623plymouth splash is not being displayedubuntu-gnome-default-settingstim@feathertop.org2016-02-252016-02-250
1534003fwts corrupts RTC wakealarm time on wakealarm testfwtsivan.hu@ubuntu.com2016-01-142016-02-2542
1536606fwts: fadt test should sanity check differences between 32 and 64 bit PM registersfwtsivan.hu@ubuntu.com2016-01-212016-02-2535
1545099fwts: update to lastest version of ACPICA 20160212fwtsivan.hu@ubuntu.com2016-02-122016-02-2513
1547469fwts: double free when running "make test" on i386 xenialfwtsivan.hu@ubuntu.com2016-02-192016-02-256
1547554fwts: rsdp test fails on i386 and not amd64 archesfwtsivan.hu@ubuntu.com2016-02-192016-02-256
1547602fwts: rsdp test should be only run on supported architecturesfwtsivan.hu@ubuntu.com2016-02-192016-02-256
1549429fwts: build failure on fadt tests with gcc 4.6 (trusty)fwtsivan.hu@ubuntu.com2016-02-242016-02-251
1549677linux-*: builds failing -- "Can't use 'defined(@array)'"linux-hammerheadapw@canonical.com2016-02-252016-02-250
1543794isc-dhcp-server fails to start on second & further attempts with 'Can't open /var/lib/dhcp/dhcpd.leases for append'isc-dhcpjamie@ubuntu.com2016-02-092016-03-0121
1473691[FFe] squid: Update to latest upstream release (3.5)squid3robie.basak@ubuntu.com2015-07-112016-04-04268
1547517libdpdk should link against the library it usesdpdkchristian.ehrhardt@canonical.com2016-02-192016-02-2910
1533367ffmpeg allows Server-Side Request Forgery attackffmpegiain@orangesquash.org.uk2016-01-122016-02-2544
1549919neutron-server fails to use configured plugin configuration fileneutronjames.page@ubuntu.com2016-02-252016-02-261
1523199Wily installer uses wrong seed location for systemd-random-seed.serviceubiquitymathieu-tl@ubuntu.com2015-12-062016-02-2682
1549816ubiquity crashed with AttributeError in set_allow_nonfree(): 'PageGtk' object has no attribute 'prepare_foss_disclaimer_extra'ubiquitymathieu-tl@ubuntu.com2016-02-252016-02-261
1480144cleanbuild (through lxd)snapcraftsergio.schvezov@ubuntu.com2015-07-312016-02-25209
1541011The project has gotten complex, againsnapcraftsergio.schvezov@ubuntu.com2016-02-022016-02-2523
1544540Provide a way to automatically generate docs from 'help' commandsnapcraftsergio.schvezov@ubuntu.com2016-02-112016-02-2514
1546771typo on examples tests, no internal commands being runsnapcraftsergio.schvezov@ubuntu.com2016-02-172016-02-258
1546821please add -all-root and -no-xattrs to mksquashfs optionssnapcraftsergio.schvezov@ubuntu.com2016-02-182016-02-257
1548915snapcraft without argumens should just snapsnapcraftsergio.schvezov@ubuntu.com2016-02-232016-02-252
1549831sys.stdout.detach does not work when debuildingsnapcraftsergio.schvezov@ubuntu.com2016-02-252016-02-250
1549880.travis.yml needs to catch up with lxd's latest outputsnapcraftsergio.schvezov@ubuntu.com2016-02-252016-02-250
1549665getch returning ENOENTscserge.hallyn@ubuntu.com2016-02-252016-02-250
1445739catfish launch scriptcatfishsmd.seandavis@gmail.com2015-04-182016-02-26314
1508918Deleting from search resultscatfishsmd.seandavis@gmail.com2015-10-222016-02-26127
1514018Catfish calculates end date in custom range incorrectlycatfishsmd.seandavis@gmail.com2015-11-072016-02-26111
1547807Need to click in empty space for right click options to workcatfishsmd.seandavis@gmail.com2016-02-202016-02-266
1550108libpipeline example will fail when skiping the install snapcraftsergio.schvezov@ubuntu.com2016-02-262016-02-260
1549407Please merge with Debian unstable php7.0 7.0.3-9php7.0nish.aravamudan@canonical.com2016-02-242016-03-1217
1547629Using of IPv6 address in url for preseed file causes an error in installerpreseedxnox@ubuntu.com2016-02-192016-02-2910
1546654Standard configuration proposal onboardfrancesco.fumanti@gmx.net2016-02-172016-02-269
1550254[Xenial] openvswitch-switch installs dpdk on upgradeopenvswitchjames.page@ubuntu.com2016-02-262016-02-271
1550004Missing Neutron Linux Bridge Cleanup init files (Upstart / SysV / Systemd)neutronjames.page@ubuntu.com2016-02-252016-02-261
1550223when using multi config files, the main project config file should be firstopenstack-pkg-toolsjames.page@ubuntu.com2016-02-262016-02-260
1550188oslo_concurrency.lock_path: sensible default value is missingpython-oslo.concurrencycorey.bryant@canonical.com2016-02-262016-02-271
1550350missing resourcespython-designateclientcorey.bryant@canonical.com2016-02-262016-02-260
1550381lxd should be a suggestion, not a direct dependencysnapcraftsergio.schvezov@ubuntu.com2016-02-262016-02-260
1550325gnome-language-selector is not MATE compatible [debdiff attached]language-selectorcode@flexion.org2016-02-262016-02-260
1545515xenial popularity-client submits compressed reportspopularity-contestbrian@ubuntu.com2016-02-142016-02-2612
1545517xenial popularity-client regards successful popcon.ubuntu.com submissions as failurespopularity-contestbrian@ubuntu.com2016-02-142016-02-2612
1550448[PowerVM] Ubuntu 16.04 does not install bootloader on multiple PReP partitions in Software RAID1 configurationgrub-installermauricfo@linux.vnet.ibm.com2016-02-262016-02-260
1328689ecryptfs-utils does not work with Ubuntu 14.04, neither with 16.04ecryptfs-utilskirkland@ubuntu.com2014-11-172016-02-27467
1541961lubuntu depends on gnome-mplayer, gmtk, removed from Debiangmtkgilir@ubuntu.com2016-02-042016-02-2723
1434774lxpanel volume applet settings opens empty terminal windowlubuntu-default-settingsgilir@ubuntu.com2015-03-212016-04-21397
1545707Error message "Operation failed: No such file or directory" on installing/reconfiguring systemdsystemdmartin.pitt@ubuntu.com2016-02-152016-04-2065
1543334upgrade to pkg-php-tools 1.32pkg-php-toolsnish.aravamudan@canonical.com2016-02-082016-02-2921
1549046php-zeta-base unit tests fail due to png optimization in php-zeta-unit-testphp-zeta-unit-testnish.aravamudan@canonical.com2016-02-242016-02-295
1548933It only shows installed apps, not available onesgnome-softwarerobert.ancell@canonical.com2016-02-232016-03-017
1543903PRINTSCREEN window (Shift-F7) loads vim when EDITOR env variable is set to emacsbyobukirkland@ubuntu.com2016-02-102016-04-0858
1550687Select session does not work with python 2byobukirkland@ubuntu.com2016-02-272016-04-0841
1549552php packages: add php-xml dependenciesphpunitsteve.langasek@ubuntu.com2016-02-252016-03-1216
1536335package resolvconf 1.78ubuntu1 failed to install/upgrade: le sous-processus script post-installation installé a retourné une erreur de sortie d'état 1resolvconfmartin.pitt@ubuntu.com2016-01-202016-02-2940
1541575zipl-installer: set up re-IPL to boot newly installed Ubuntu/Linuxzipl-installerxnox@ubuntu.com2016-02-032016-02-2926
1541581s390/template-arch: set always_halt to false to allow rebootsrootskelxnox@ubuntu.com2016-02-032016-02-2926
1550577lxsession-logout should depend on consolekit | systemdlxsessioninfo@g-com.eu2016-02-262016-02-293
1541914passwd depends on init-system-helpers (>= 1.18~); however: Version of init-system-helpers on system is 1.14upstartmartin.pitt@ubuntu.com2016-02-042016-04-1167
1530855omniORB C++ server halts in some circumstancesomniorb-dfsgmichal.strnad@nic.cz2016-01-042016-02-2956
1543817php-guzzlehttp-psr7: add nocheck and stage1 build profilesphp-guzzlehttp-psr7nish.aravamudan@canonical.com2016-02-092016-02-2920
1551158DPDK dep8 tests failing on non supported platformsdpdkchristian.ehrhardt@canonical.com2016-02-292016-02-290
1543850phpunit-global-state: add nocheck and stage1 build profilesphpunit-global-statenish.aravamudan@canonical.com2016-02-092016-02-2920
1548411Installing Ubuntu as KVM guest is not possible because the installer fails to detect Virtual Disk correctlypartman-partitioningxnox@ubuntu.com2016-02-292016-02-290
1544101Rebase qclib >= 1.1.0qclibxnox@ubuntu.com2016-02-102016-02-2919
1550534Suggestions arrows not available on Compact layoutonboardfrancesco.fumanti@gmx.net2016-02-292016-02-290
1430546apparmor kernel BUG kills firefoxlinuxtim.gardner@canonical.com2015-03-102016-03-02358
1448912BUG: unable to handle kernel NULL pointer dereference (aa_label_merge)linuxtim.gardner@canonical.com2015-05-222016-03-02285
1507588linux is missing provides for virtualbox-guest-modules [i386 amd64 x32]linuxtim.gardner@canonical.com2015-10-192015-11-0517
1519631[Feature]EDAC support for Knights Landinglinuxtim.gardner@canonical.com2016-01-132016-03-0249
1531327Various failures of kernel_security suite on Xenial kernel on s390x archlinuxtim.gardner@canonical.com2016-02-092016-03-0222
1532914Surelock GA2 SP1: capiredp01: cxl_init_adapter fails for CAPI devices 0000:01:00.0 and 0005:01:00.0 after upgrading to 840.10 Platform firmware build fips840/b1208b_1604.840linuxtim.gardner@canonical.com2016-01-112016-03-0251
1540390Backport more recent driver for SKL, KBL and BXT graphicslinuxtim.gardner@canonical.com2016-02-012016-03-0230
1548414Floating-point exception handler receives empty Data-Exception Code in Floating Point Control registerlinuxtim.gardner@canonical.com2016-02-222016-03-029
1549494arm64: guest hangs when ntpd is runninglinuxtim.gardner@canonical.com2016-02-242016-04-1955
1550468s390x: correct restore of high gprs on signal returnlinuxtim.gardner@canonical.com2016-02-262016-03-025
1550517missing SMAP supportlinuxtim.gardner@canonical.com2016-02-262016-03-025
1550596kvm fails to boot GNU Hurd kernels with 4.4 Xenial kernellinuxtim.gardner@canonical.com2016-02-272016-03-024
1551319linux: 4.4.0-9.24 -proposed trackerlinuxtim.gardner@canonical.com2016-02-292016-03-022
1549942php-imagick failing autopkgtestsimagemagicknish.aravamudan@canonical.com2016-03-072016-03-081
1540591fontconfig breaks Trusty - Xenial upgradefontconfigiain@orangesquash.org.uk2016-02-012016-03-0129
1547208package libvirt-bin=1.3.1-1ubuntu1 fails to install due to new virtlockd initd scriptlibvirtstefan.bader@canonical.com2016-02-182016-03-0112
1551643libvirt-bin should also use provides libvirt-daemonlibvirtstefan.bader@canonical.com2016-03-012016-03-010
1549850ncal crashes with segmentation faultbsdmainutilsxnox@ubuntu.com2016-02-252016-03-048
1551828kpartx causes kernel oops when NVMe devices is not in blacklistmultipath-toolsmathieu-tl@ubuntu.com2016-03-012016-03-010
1549502doesn't exit on close, which confuses the unity dashgnome-softwarerobert.ancell@canonical.com2016-02-242016-03-027
1551702Software Sources under menu is emptygnome-softwarerobert.ancell@canonical.com2016-03-012016-03-021
1551923mount name=systemdcgroup-liteserge.hallyn@ubuntu.com2016-03-012016-03-021
1551850featured and editors picks gonegnome-softwarerobert.ancell@canonical.com2016-03-012016-03-021
1546847Fonts-droid has been deprecated and removed, use fonts-droid-fallback instead of fonts-droidubuntukylin-themezhangchao@ubuntukylin.com2016-02-182016-03-0314
1551763Calendar: New name inconsistencygnome-calendarseb128@ubuntu.com2016-03-012016-03-021
1551766Calendar: change colour has no effectgnome-calendarseb128@ubuntu.com2016-03-012016-03-021
1551877[ffe] update gnome-calendar to 3.19gnome-calendarseb128@ubuntu.com2016-03-012016-03-021
1551989Demote deja-dup-backend-gvfs and install on demanddeja-dupmterry@ubuntu.com2016-03-012016-03-032
1520454[Feature]SD/SDIO/eMMC support for Broxton-Plinuxtim.gardner@canonical.com2016-03-012016-03-2120
1545330[wily][regression] systemtap script compilation broken by new kernelslinuxtim.gardner@canonical.com2016-02-292016-03-044
1551894linux: 4.4.0-9.X fails yama ptrace restrictions testslinuxtim.gardner@canonical.com2016-03-012016-03-043
1552247linux: 4.4.0-10.25 -proposed trackerlinuxtim.gardner@canonical.com2016-03-022016-03-042
1544764ephemeral-disk-warning.conf should run ephemeral-disk-warning.shwalinuxagentben.howard@ubuntu.com2016-02-112016-03-0220
1550461walinuxagent conflicts with networkmanagerwalinuxagentben.howard@ubuntu.com2016-02-262016-03-025
1552488linux-raspi2: 4.4.0-1002.3 -proposed trackerlinux-raspi2paolo.pisati@canonical.com2016-03-032016-03-085
1551943Don't use HeaderBar in Unitygnome-softwarerobert.ancell@canonical.com2016-03-012016-03-032
1552733console-setup.service always fails on s390xconsole-setupxnox@ubuntu.com2016-03-032016-03-041
1547865Double free in libjasper jas_icc.cjaspertyhicks@canonical.com2016-02-202016-03-0312
1543697Unprivileged nested Xenial container will not start inside a privileged Xenial containerlxcstgraber@ubuntu.com2016-02-092016-03-0323
1549363Unprivileged LXC will not start after today's updateslxcstgraber@ubuntu.com2016-02-242016-03-038
1551935lxc-copy message is the wrong way aroundlxcstgraber@ubuntu.com2016-03-012016-03-032
1551960lxc-attach does not work any more with input redirectionlxcstgraber@ubuntu.com2016-03-012016-03-032
1552355Unprivileged lxc will not start after being stoppedlxcstgraber@ubuntu.com2016-03-022016-03-031
1550927Wrong update prompt after wily to xenial upgradeubuntu-release-upgraderbrian@ubuntu.com2016-02-282016-03-1112
1551929Cannot upgrade to 15.10 using alternate AMD64 ISOubuntu-release-upgraderbrian@ubuntu.com2016-03-012016-03-1110
1549510"screenshot not valid"appstream-glibrobert.ancell@canonical.com2016-02-242016-03-038
1510198[FFe] Sync (almost) with libreoffice-dictionaries in Debian sidlanguage-selectorgunnarhj@ubuntu.com2016-03-012016-03-043
1553069ubuntu-touch vivid rootfs fails to build: cp: cannot stat 'chroot/usr/share/android/product/*-preinstalled-system-armel+manta.img': No such file or directorylivecd-rootfslukasz.zemczak@ubuntu.com2016-03-042016-03-040
1553160/usr/bin/gnome-software:11:gs_page_app_installed_cb:g_task_return_now:complete_in_idle_cb:g_main_dispatch:g_main_context_dispatchgnome-softwareseb128@ubuntu.com2016-03-042016-03-040
1546430python-kombu should require python-amqp >=1.4.9kombujames.page@ubuntu.com2016-03-042016-03-040
1553017Unable to deploy xenial on MAAS / resolv.conf not populatedopen-iscsismoser@ubuntu.com2016-03-042016-03-040
1553251USN-2915-1 introduced a regression in is_safe_url()python-djangomarc.deslauriers@ubuntu.com2016-03-042016-03-040
1539361Empty items displayed in language listubuntu-touch-metaken.vandine@canonical.com2016-01-292016-03-0435
1542371Request Package: genwqe-user >= 4.0.10genwqexnox@ubuntu.com2016-02-052016-03-0832
1543025Wrong UTC zoneinfo in cloud-imagescloud-initsmoser@ubuntu.com2016-02-082016-03-0425
1553107initramfs-tools: UUID checks now fail for NTFS which has upper cases UUIDSinitramfs-toolsapw@ubuntu.com2016-03-042016-03-062
1552314[s390x] zfcp.ko missing from scsi-modules udeblinuxtim.gardner@canonical.com2016-03-022016-03-086
1552332[Ubuntu 16.04] Help to flush kernel panics to consolelinuxtim.gardner@canonical.com2016-03-022016-03-086
1552627mlx4_en didn't choose time-stamping shift value according to HW frequencylinuxtim.gardner@canonical.com2016-03-032016-03-085
1553179Xenial update to v4.4.4 stable releaselinuxtim.gardner@canonical.com2016-03-042016-03-084
1553391linux: 4.4.0-11.26 -proposed trackerlinuxtim.gardner@canonical.com2016-03-042016-03-084
1553923please merge llvm-toolchain-3.8 from Debianllvm-toolchain-3.8locutusofborg@debian.org2016-03-072016-03-092
1552939arm64 build doesn't use asm and is 4x-16x slower than it could beopenssldannf@ubuntu.com2016-03-032016-03-096
1554186walinuxagent ephemeral warning lacks full command for removal of filewalinuxagentben.howard@ubuntu.com2016-03-072016-03-070
1554152pollinate fails in many circumstances, cloud-init reports that failure, maas reports node failed deploymentpollinatekirkland@ubuntu.com2016-03-072016-03-070
1554269add libpam-cgfs to common-session-interactivelxcfsserge.hallyn@ubuntu.com2016-03-082016-03-080
1552868Demote python3-smbc to a Suggestssystem-config-printertill.kamppeter@gmail.com2016-03-032016-03-085
1533728libvirt unable to create more than one snapshotqemuserge.hallyn@ubuntu.com2016-01-132016-03-1461
1551854LXD bootstrap issues on xeniallxdstgraber@ubuntu.com2016-03-012016-03-087
1248054[SRU] dlm package installation failsdlmjames.page@ubuntu.com2013-11-052016-03-08854
1491745Package does not ship dlm_stonithdlmjames.page@ubuntu.com2015-09-032016-03-08187
1546717Merge with Debian version 2.0-7commons-vfsnish.aravamudan@canonical.com2016-02-172016-04-0649
1495828xchat-gnome crashed with SIGFPE in gtk_xtext_check_ent_visibility()xchat-gnomeseb128@ubuntu.com2015-09-152016-03-08175
155120816.04 Default Wallpaperubuntu-wallpapersiain.lane@canonical.com2016-02-292016-03-088
1554393Missing files in libgstreamer-plugins-bad-devgst-plugins-bad1.0iain.lane@canonical.com2016-03-082016-03-080
1543165kernel: update kernel configurationlinuxtim.gardner@canonical.com2016-02-082016-03-1132
1546572Pull in upstream AMD code (amdgpu) in Xeniallinuxtim.gardner@canonical.com2016-02-172016-03-1123
1552632mlx4_core Set UAR page size to 4KB regardless of system page sizelinuxtim.gardner@canonical.com2016-03-032016-03-118
1554608Radeon hybrid graphics problem on resumelinuxtim.gardner@canonical.com2016-03-082016-03-113
1554704linux: 4.4.0-12.28 -proposed trackerlinuxtim.gardner@canonical.com2016-03-082016-03-113
1550741Upgrade failed - unauthenticated package (module-init-tools)kmodapw@ubuntu.com2016-03-012016-03-109
1553156evince not listedevincerobert.ancell@canonical.com2016-03-082016-03-080
1554520Please update ubuntu-mate-meta packageubuntu-mate-metadaniel.holbach@ubuntu.com2016-03-082016-03-091
1551601DPDK init scripts need some hardening against broken specifications in /etc/dpdk/interfacesdpdkchristian.ehrhardt@canonical.com2016-03-012016-03-109
1551752DPDK Testpmd failing with Xen specific gntalloc in non-Xen environmentsdpdkchristian.ehrhardt@canonical.com2016-03-012016-03-109
1551767DPDK hugepage config in /etc/dpdk/dpdk.conf should provide 1G pages as welldpdkchristian.ehrhardt@canonical.com2016-03-012016-03-109
1551796DPDK build should avoid using uname -mdpdkchristian.ehrhardt@canonical.com2016-03-012016-03-109
1554214Usege of vfio-pci module via /etc/dpdk/interfaces doesn't workdpdkchristian.ehrhardt@canonical.com2016-03-072016-03-103
1554397dpdk-init fails due to missing modules in virt environmentsdpdkchristian.ehrhardt@canonical.com2016-03-082016-03-102
1547672invalid package name in "build-packages" message is not very helpfulsnapcraftsergio.schvezov@ubuntu.com2016-02-192016-03-1020
1547681in snapcraft plugin, direct import of BaseHandler causes problemssnapcraftsergio.schvezov@ubuntu.com2016-02-192016-03-1020
1548370Catkin plugin: Confusing print when dependency is an invalid packagesnapcraftsergio.schvezov@ubuntu.com2016-02-222016-03-1017
1548404Catkin plugin: Can't handle rosdep resolving to multiple packagessnapcraftsergio.schvezov@ubuntu.com2016-02-222016-03-1017
1548406Catkin plugin: Can't handle rosdep resolving to nothingsnapcraftsergio.schvezov@ubuntu.com2016-02-222016-03-1017
1548492Snapcraft swallows exceptionssnapcraftsergio.schvezov@ubuntu.com2016-02-222016-03-1017
1549427migrate from skills to interfacessnapcraftsergio.schvezov@ubuntu.com2016-02-242016-03-1015
1550379travis script file has unnecessary complexitiessnapcraftsergio.schvezov@ubuntu.com2016-02-262016-03-1013
1551417Support parallel buildssnapcraftsergio.schvezov@ubuntu.com2016-02-292016-03-1010
1551939The call to which sends output to stdout.snapcraftsergio.schvezov@ubuntu.com2016-03-012016-03-109
1552160Support restart-conditionsnapcraftsergio.schvezov@ubuntu.com2016-03-022016-03-108
1552403Remove useless decode in test runnersnapcraftsergio.schvezov@ubuntu.com2016-03-022016-03-108
1552498catkin plugin uses unhashables for dependenciessnapcraftsergio.schvezov@ubuntu.com2016-03-032016-03-107
1554637libpipeline example fails because it is now run in an empty dirsnapcraftsergio.schvezov@ubuntu.com2016-03-082016-03-102
1554641libpipeline example needs to be reviewedsnapcraftsergio.schvezov@ubuntu.com2016-03-082016-03-102
1555013Clean up /etc/cron.hourly/lxdlxdstgraber@ubuntu.com2016-03-092016-03-090
1555052ubuntu-fan: newer versions of docker do not require the -d option to deamoniseubuntu-fanapw@ubuntu.com2016-03-092016-03-090
1553870apt sources contain "True" entries after upgrade to xenialapt-clonemathieu-tl@ubuntu.com2016-03-072016-03-103
1552790FFe: docker.io 1.10.2 upload to xenialdocker.iotianon@debian.org2016-03-032016-03-107
1555362log the right pidpollinatekirkland@ubuntu.com2016-03-092016-03-090
1539642Integrate zfcp HBA API library 2.1.1zfcp-hbaapixnox@ubuntu.com2016-01-292016-03-1142
1508192Mousepad search highlights hard to seexubuntu-artworksmd.seandavis@gmail.com2016-02-252016-03-1014
1554878fix up usage of XDG_CURRENT_DESKTOPgtk+3.0robert.ancell@canonical.com2016-03-102016-03-100
1393842libvirt does not grant qemu-guest-agent channel permslibvirtserge.hallyn@ubuntu.com2014-11-212016-03-31496
1554761missing rules for block-iscsi.so and block-dmg.solibvirtserge.hallyn@ubuntu.com2016-03-082016-03-102
1546649Pops up update dialoggnome-softwarerobert.ancell@canonical.com2016-02-172016-03-1022
1552150gnome-software crashed with SIGSEGV in g_menu_model_get_n_items()gnome-softwarerobert.ancell@canonical.com2016-03-022016-03-108
1554160changelogs start with source names and the parser uses the binary onegnome-softwarerobert.ancell@canonical.com2016-03-072016-03-103
1515096Remove gst-plugins-bad-multiverse0.10 from archive in Xenialubuntu-restricted-extrasmartin.pitt@ubuntu.com2016-02-112016-03-1028
1550896Move GConf depends to a seperate binarypidgintim@feathertop.org2016-02-282016-03-1011
1550405ubuntu-core-launcher still exporting SNAPP_APP_TMPDIRubuntu-core-launchermichael.vogt@ubuntu.com2016-02-262016-03-1013
1554004Segfault on X startup with VX900xserver-xorg-video-openchromedariusz.gadomski@canonical.com2016-03-072016-03-103
1553261[FFe] Standing FFe for MAAS 2.0maasandreserl@ubuntu.com2016-03-042016-03-106
1520772New font uses Arabic-sized figures in Latin contextsubuntu-font-family-sourcesiain@orangesquash.org.uk2015-11-282016-03-10103
1555244crash fails to load with 4.4+ kernelscrashlouis.bouchard@ubuntu.com2016-03-092016-03-101
1465050Size of /boot partition is too smallpartman-automathieu-tl@ubuntu.com2015-06-142016-03-21281
1555738Merge kerneloops from Debian for Xenialkerneloopsstefan.bader@canonical.com2016-03-102016-03-100
1408672Please drop huge oxideqt-dbg packageoxide-qtchris.coulson@canonical.com2015-01-082016-03-11428
1543587Duplicate targets and random mis-builds due to Chromedriveroxide-qtchris.coulson@canonical.com2016-03-102016-03-100
1546743Error when upgrading landscape-client to 16.01~bzr829-0ubuntu0~ubuntu14.04.1landscape-clientandreas@canonical.com2016-02-172016-03-1426
1551283ibus/im-config in Ubuntu GNOMElanguage-selectorgunnarhj@ubuntu.com2016-03-022016-03-119
1555861[FFe] We need criu 2.0 in the archivecriustgraber@ubuntu.com2016-03-102016-03-111
1553023[FFe] libvirt v1.3.2 -- zfs supportlibvirtserge.hallyn@ubuntu.com2016-03-042016-03-2117
1554031error: internal error: unable to execute QEMU command ‘block-commit’: Could not reopen file: Permission deniedlibvirtserge.hallyn@ubuntu.com2016-03-072016-03-114
1555960Some text (in buttons, dropdown menus) renders incorrectlyxorg-servertjaalton@debian.org2016-03-112016-03-110
1555819Upgrade to latest stable version 1.5.1 of Python Shadepython-shadejames.page@ubuntu.com2016-03-102016-03-111
1554134[FFe] python-django-compressor 2.0python-django-compressorjames.page@ubuntu.com2016-03-072016-03-114
1552283ubuntu-mate-settings 16.04.3 release [debdiff attached]ubuntu-mate-settingscode@flexion.org2016-03-022016-03-119
1499521Mate on Ubuntu Mate 15.04 and 15.10 slow time loading the menu items for officeubuntu-mate-artworkcode@flexion.org2015-09-262016-03-02158
1552363Update index.theme to inherit all Ubuntu MATE icons.ubuntu-mate-artworkcode@flexion.org2016-03-022016-03-119
1552712ubuntu-mate-artwork 16.04.3 new release [debdiff and tarball attached]ubuntu-mate-artworkcode@flexion.org2016-03-032016-03-118
1552816Sync bugfix release taskcoach 1.4.3-1 (universe) from Debian unstable (main)taskcoachtimo-jyrinki@ubuntu.com2016-03-032016-03-118
1374759>>>WARNING<<< Wrong ufstype may corrupt your filesystem, default is ufstype=oldos-proberstefan.bader@canonical.com2014-10-092016-03-11519
1556143fail to upgrade fuse in xenial, in lxdfusexnox@ubuntu.com2016-03-112016-03-110
1413474-fsanitize=thread fails to link; needs -ltsangcc-5doko@ubuntu.com2015-01-222016-03-12415
1485511ISST-KVM:CTE:R3-0:raing12: Base system install fails with "Debootstrap Error :Invalid Release signature (key id 40976EAF437D05B5) " using Ubuntu 15.10 latest daily build (20150805)debootstrapmathieu-tl@ubuntu.com2015-08-172016-03-11207
1494350QEMU: causes vCPU steal time overflow on live migrationlinuxtim.gardner@canonical.com2016-03-092016-03-101
1552903fails to boot on megaraidlinuxtim.gardner@canonical.com2016-03-112016-03-154
1555033linux: review all versioned depends/conflicts/replaces/breaks for validilitylinuxtim.gardner@canonical.com2016-03-092016-03-156
1555338Linux netfilter IPT_SO_SET_REPLACE memory corruptionlinuxtim.gardner@canonical.com2016-03-092016-03-156
1555353integer overflow in xt_alloc_table_infolinuxtim.gardner@canonical.com2016-03-092016-03-156
1555543linux: auto-generate the reconstruct information from the git taglinuxtim.gardner@canonical.com2016-03-102016-03-155
1555640Xenial update to v4.4.5 stable releaselinuxtim.gardner@canonical.com2016-03-102016-03-155
1555765Backport upstream bugfixes to ubuntu-16.04linuxtim.gardner@canonical.com2016-03-102016-04-1940
1556002ALSA: hda - add codec support for Kabylake display audio codeclinuxtim.gardner@canonical.com2016-03-112016-03-154
1556037[Hyper-V] network performance patches for Xenial 16.04linuxtim.gardner@canonical.com2016-03-112016-03-154
1556141s390/mm: four page table levels vs. forklinuxtim.gardner@canonical.com2016-03-112016-03-187
1556247linux: 4.4.0-13.29 -proposed trackerlinuxtim.gardner@canonical.com2016-03-112016-03-154
1556277When using unity, the diplomacy and cities menus are not shown for freeciv-gtk3unity-gtk-modulepersia@ubuntu.com2016-03-112016-03-110
1513367qemu-system-x86_64/kvm-spice failed to boot a vm with appmor enabledlibvirtserge.hallyn@ubuntu.com2015-11-052016-04-07154
1555843php7.0: re-add binary packages with universe dependenciesphp-universe-source7.0nish.aravamudan@canonical.com2016-03-112016-03-121
1538532Broken in Xenial, vim requires python3 nowycmddoko@ubuntu.com2016-01-272016-04-0569
1540063Slideshow output in different font when install in Japanese. (16.04)language-selectorgunnarhj@ubuntu.com2016-03-132016-03-163
1488333Search is accent sensitivepasaffemarc.deslauriers@ubuntu.com2015-08-252016-02-24183
1546214Docker containers lose their cgroup after systemd reloaddocker.iomartin.pitt@ubuntu.com2016-02-162016-03-1326
1551489merge with 1.6-1 from Debian unstablegolangmichael.hudson@canonical.com2016-03-012016-03-1413
1553797Provide a way to Update AppArmor rules for click tests only onceautopkgtestmartin.pitt@ubuntu.com2016-03-062016-03-159
1556539package sysvinit-utils 2.88dsf-41ubuntu6.3 failed to install/upgrade: installing sysvinit-utils would break existing softwareutil-linuxmartin.pitt@ubuntu.com2016-03-132016-03-141
1539317default user should be in the lxd groupcloud-initsmoser@ubuntu.com2016-01-292016-03-1445
1553419php7.0: update to latest version of packages from Debian unstablephp7.0nish.aravamudan@canonical.com2016-03-052016-03-1611
1556486package php7.0-common 7.0.3-3 [modified: usr/share/doc/php7.0-common/NEWS.Debian.gz usr/share/doc/php7.0-common/changelog.Debian.gz] failed to install/upgrade: tentative de remplacement de « /usr/lib/php/20151012/pdo.so », qui appartient aussi au paquet php7.0-interbase 7.0.3-9ubuntu2php7.0nish.aravamudan@canonical.com2016-03-122016-03-164
1557189linux-raspi2: 4.4.0-1004.5 -proposed trackerlinux-raspi2tim.gardner@canonical.com2016-03-142016-03-162
1556447lxc-start fails: lxc_cgfsng - cgfsng.c:all_controllers_found:430 - no systemd controller mountpoint foundlxcfsserge.hallyn@ubuntu.com2016-03-142016-03-151
1556651FFe: Update plank to 0.11.0ubuntu-mate-settingscode@flexion.org2016-03-132016-03-152
1556711ubuntu-mate-settings 16.04.4 release [debdiff attached]ubuntu-mate-settingscode@flexion.org2016-03-142016-03-151
1546735openipmi package compile without SSLopenipmislashd@ubuntu.com2016-02-172016-03-1527
1380364lightdm writes XDISPLAY instead of tty device name to utmp recordlightdmrobert.ancell@canonical.com2016-03-152016-03-150
1557280update apport hook for gdm3 changesgnome-shelltim@feathertop.org2016-03-152016-03-150
1549723fwts: memory leak when reading MSRs when checking if check if CPU has C1E bitfwtsalex.hung@ubuntu.com2016-02-252016-03-1519
1549737fwts: Add s390x arch to architecture listfwtsalex.hung@ubuntu.com2016-02-252016-03-1519
1553043uefi: add sanity check for esrt tablefwtsalex.hung@ubuntu.com2016-03-042016-03-2824
1556720acpi: method: fix faile check on _EC control methodfwtsalex.hung@ubuntu.com2016-03-142016-03-2814
1557327kvm-ok script gives syntax error when running on kvmcpu-checkerwgrant@ubuntu.com2016-03-152016-03-150
1557405AppStream icon for amule.desktopamuleiain@orangesquash.org.uk2016-03-152016-03-150
1557151ZFS: send fails to transmit some holes [corruption]zfs-linuxtim.gardner@canonical.com2016-03-142016-03-195
1527643use after free of task_struct->numa_faults in task_numa_find_cpulinuxtim.gardner@canonical.com2015-12-182016-03-1992
1555997overlay fs regression: chmod fails with "Operation not permitted" on chowned fileslinuxtim.gardner@canonical.com2016-03-112016-03-198
1557130Current 4.4 kernel won't boot on powerpclinuxtim.gardner@canonical.com2016-03-142016-03-195
1557138Request to cherry-pick uvcvideo patch for Xenial kernel support of RealSense cameralinuxtim.gardner@canonical.com2016-03-142016-03-195
1557508linux: 4.4.0-14.30 -proposed trackerlinuxtim.gardner@canonical.com2016-03-152016-03-194
1556304Please merge memcached 1.4.25-2 from Debian unstablememcachednish.aravamudan@canonical.com2016-03-112016-03-154
1556265Please merge nagios3 3.5.1.dfsg-2.1 from Debian unstablenagios3nish.aravamudan@canonical.com2016-03-112016-03-154
1555357Please merge checksecurity 2.0.16+nmu1 from Debian unstablechecksecuritynish.aravamudan@canonical.com2016-03-092016-03-156
1556300Please merge ebtables 2.0.10.4-3.4 from Debian unstableebtablesnish.aravamudan@canonical.com2016-03-112016-03-154
1557599php packages: add php-mbstring dependencyphp-sabre-dav-2.1nish.aravamudan@canonical.com2016-03-152016-03-161
1318317openipmi startup script removes kernel modulesopenipminish.aravamudan@canonical.com2014-05-112016-03-15674
1107859Hyphenation of Russian text doesn't work in Firefox due to unrecognized encodinghyphen-rugunnarhj@ubuntu.com2013-01-282016-03-151142
1553390GRUB timeout is ~10x too long on arm64/uefigrub2mathieu-tl@ubuntu.com2016-03-042016-03-1511
1549347[FFe] Please update nginx to 1.9.12nginxteward@ubuntu.com2016-02-242016-03-1520
1556996Sync bugfix release epiphany-browser 3.18.4-1 (universe) from Debian testing (main)epiphany-browsertim@feathertop.org2016-03-142016-03-151
1552004php-cache-lite: update to PHP7.0 compliant php-pear dependencyphp-cache-litenish.aravamudan@canonical.com2016-03-012016-03-1514
1557787client/server RCEs in path_name()gitadconrad@ubuntu.com2016-03-152016-03-2510
1554167the changelog formatting code isn't adapted to the contentgnome-softwarerobert.ancell@canonical.com2016-03-072016-03-169
1556356Menu item label "Software Sources" -> "Software & Updates"gnome-softwarerobert.ancell@canonical.com2016-03-122016-03-164
1556586apt-plugin.patch causes failures with .CAB filesgnome-softwarerobert.ancell@canonical.com2016-03-132016-03-163
1557803[UIFe] Include refreshed mime icons from upstreamxubuntu-artworksmd.seandavis@gmail.com2016-03-152016-03-161
1546634Is "Restart & Install" appropriate for Ubuntugnome-softwarerobert.ancell@canonical.com2016-02-172016-03-1628
1552190History button seems to be always unactivegnome-softwarerobert.ancell@canonical.com2016-03-022016-03-1614
1557840gnome-software crashed with SIGSEGV in gs_app_has_quirk()gnome-softwarerobert.ancell@canonical.com2016-03-162016-03-160
1547124GTK3 Theme parsing error in gtk-widgets.css of greybird themeshimmer-themessmd.seandavis@gmail.com2016-02-182016-03-1627
1552518Linked toolbar buttons do not draw correctly in Greybirdshimmer-themessmd.seandavis@gmail.com2016-03-032016-03-1613
1555046Please upload shimmer-themes-2.1.2-0ubuntu1 to xenialshimmer-themessmd.seandavis@gmail.com2016-03-092016-03-167
1556027GTK3 file menus show thick linesshimmer-themessmd.seandavis@gmail.com2016-03-112016-03-165
1556684gnome-control-center.real crashed with SIGSEGV in g_utf8_validate()accountsservicegunnarhj@ubuntu.com2016-03-132016-03-163
1556964Update to bugfix release 2.4.10 in Trustywebkitgtkmarc.deslauriers@ubuntu.com2016-03-142016-03-173
1551819dbginfo.sh: /etc/network/ directory is not collecteds390-toolsxnox@ubuntu.com2016-03-012016-03-1615
1532355package linux-image-4.3.0-5-generic 4.3.0-5.16 failed to install/upgrade: run-parts: /etc/kernel/postinst.d/initramfs-tools exited with return code 2plymouthdidrocks@ubuntu.com2016-01-082016-03-1668
1548254Failed 15.10 -> 16.04 upgradeplymouthdidrocks@ubuntu.com2016-02-222016-03-1623
831487Dependency on package unattended-upgrades on Ubuntu Serversoftware-propertiesseb128@ubuntu.com2011-08-222016-03-231675
1554098Update s390x syscall tableslibseccompxnox@ubuntu.com2016-03-072016-03-1710
1273548sessioninstaller: Typo in package description: "adpoted"sessioninstallerseb128@ubuntu.com2014-08-302016-03-16564
1497948/usr/bin/session-installer:sessioninstaller.errors.ModifyInternalError:_inline_callbacks:_install_mime_typessessioninstallerseb128@ubuntu.com2015-09-212016-03-16177
1556705session-installer crashed with ImportError in /usr/lib/python3/dist-packages/sessioninstaller/core.py: No module named 'xdg'sessioninstallerseb128@ubuntu.com2016-03-142016-03-162
1558114package libpam-modules 1.1.8-3.1ubuntu3.1 failed to install/upgrade: trying to overwrite shared '/usr/share/man/man8/pam_unix.8.gz', which is different from other instances of package libpam-modules:i386pammarc.deslauriers@ubuntu.com2016-03-162016-03-182
1548442php7.0: segmentation fault running twig test suitephp7.0nish.aravamudan@canonical.com2016-02-222016-03-1724
1558201php-sabre-dav-2.1 testsuite failures in mb_stripos on s390xphp7.0nish.aravamudan@canonical.com2016-03-162016-03-171
1556647/usr/share/java/commons-lang.jar contains documentationlibcommons-lang-javanish.aravamudan@canonical.com2016-03-132016-03-163
1544170Port to wxwidgets 3.0 or remove from archive?wxbankermartin.pitt@ubuntu.com2016-02-102016-03-1635
1556306 vhost-user: qemu stops processing packets under high load of trafficqemuserge.hallyn@ubuntu.com2016-03-112016-03-176
1555856move to per-Go-major version coinstallable packagesgcc-5doko@ubuntu.com2016-03-102016-03-188
1556217Including "Vc" header causes ICEgcc-5doko@ubuntu.com2016-03-112016-03-187
1556869FFe: ubuntu-mate-welcome 16.04.4 new release [debdiff and tarball attached]ubuntu-mate-welcomecode@flexion.org2016-03-142016-03-173
1558125ntpd doesn't synchronize to local clock (ntpd 4.2.8p4/xenial)ntppierre-andre.morey@canonical.com2016-03-162016-03-171
1557893The transition wallpaper does not have right scale on HiDPI monitor.unity-greeterrobert.ancell@canonical.com2016-03-162016-03-171
1390627tabs being replaced by question marks in report valueswhoopsiebarry@ubuntu.com2014-11-072016-03-17496
1549890Segfault sometimes when auth deniedgnome-softwarerobert.ancell@canonical.com2016-02-252016-03-1721
1554023Perform an apt update if there is no appstream availablegnome-softwarerobert.ancell@canonical.com2016-03-072016-03-1710
1557213typo in apt error messagegnome-softwarerobert.ancell@canonical.com2016-03-142016-03-173
1558816Segfault when org.freedesktop.fwupd service doesn't existgnome-softwarerobert.ancell@canonical.com2016-03-172016-03-170
1551351dhclient does not renew leasesisc-dhcpstefan.bader@canonical.com2016-03-022016-03-1917
1556175networking.service hangs on shutdown -- killing dhclient has no effect any moreisc-dhcpstefan.bader@canonical.com2016-03-112016-03-187
1558346[upstream] K3B does not show AudioVideo category @ GNOMEk3brobert.ancell@canonical.com2016-03-172016-03-181
1558568ubuntu-gnome-desktop should depend on ibus-gtkubuntu-gnome-metatim@feathertop.org2016-03-172016-03-181
1462267Desktop icon alignment `floor()`s instead of `round()`nautilusseb128@ubuntu.com2015-06-052016-03-18287
1548977sidebar items missing with gtk 3.18 (browse network, browser, empty trash, format)nautilusseb128@ubuntu.com2016-02-232016-03-1824
1558983Ubuntu MATE Welcome is missing splash image and other art assetsubuntu-mate-welcomecode@flexion.org2016-03-182016-03-180
1558986Ubuntu MATE Welcome codec install fails because gstreamer0.10-plugins-bad is uninstallableubuntu-mate-welcomecode@flexion.org2016-03-182016-03-180
1558989ubuntu-mate-welcome 16.04.5 bug fix release [dsc attached]ubuntu-mate-welcomecode@flexion.org2016-03-182016-03-180
1555757package hyphen-en-gb (not installed) failed to install/upgrade: trying to overwrite '/usr/share/hyphen/hyph_en_GB.dic', which is also in package openoffice.org-hyphenation 0.8libreoffice-dictionariesmapreri@ubuntu.com2016-03-102016-03-188
1557334[1.9.1] Vfat & FAT32 Issuescurtinsmoser@ubuntu.com2016-03-152016-03-150
1421184Merge latest version (2.48.3-1) with Debianunisonjames.page@ubuntu.com2015-02-122016-03-18400
1556618New re-coloured appearance icon for Ubuntu MATEubuntu-mate-artworkcode@flexion.org2016-03-132016-03-185
1557229FFe: ubuntu-mate-artwork 16.04.4 new release [debdiff and tarball attached]ubuntu-mate-artworkcode@flexion.org2016-03-152016-03-183
1558534FFe: Please updated ubuntu-mate-metaubuntu-mate-metadaniel.holbach@ubuntu.com2016-03-172016-03-181
1558273install/lsscm: display storage-class memory (s390-tools package)s390-toolsxnox@ubuntu.com2016-03-162016-03-182
1558274s390-tools: new upstream release 1.34.0s390-toolsxnox@ubuntu.com2016-03-162016-03-182
1558277install/cpumf: work with the CPU-measurement facilities (s390-tools)s390-toolsxnox@ubuntu.com2016-03-162016-03-182
1558709s390-tools/install: add zdsfs and HMC DVD access fuse file systemss390-toolsxnox@ubuntu.com2016-03-172016-03-181
1559188s390-tools dbginfo.sh terminates at step 6 of 8 with rc=2s390-toolsxnox@ubuntu.com2016-03-182016-03-180
1555159Crashkernel parameter is not availablezipl-installerxnox@ubuntu.com2016-03-092016-03-189
1516403Upper angles of window not curvedgtk+3.0marco@ubuntu.com2016-03-072016-04-0125
1558848symfony: failing autopkgtestsphp-monolognish.aravamudan@canonical.com2016-03-182016-03-180
1327412Delay during PXE Boot, IP-Config gives upklibcmathieu-tl@ubuntu.com2014-06-062016-03-18651
1559135GtkSalMenu: menu File>Templates>Manage executes action from the wrong submenulibreoffice-l10nbjoern.michaelsen@canonical.com2016-03-182016-03-213
1559070Images referenced by absolute path don't loadubuntu-docsgunnarhj@ubuntu.com2016-03-182016-03-191
1470523Deprecated gtk properties in data/LanguageSelector.uilanguage-selectorgunnarhj@ubuntu.com2015-07-012016-03-19262
1558438"Disable secure boot" workflow is brokendkmsmathieu-tl@ubuntu.com2016-03-172016-03-192
1559169containers no longer start after upgrade to 2.0.0~rc11-0ubuntu1lxcfsstgraber@ubuntu.com2016-03-182016-03-191
1544318php-doctrine-data-fixtures: update to PHP7.0 dependenciesphp-doctrine-data-fixturesnish.aravamudan@canonical.com2016-02-102016-03-1938
1550852apt-mirror does not reflect dep11/Components-* and dep11/icons-*apt-mirrortjaalton@debian.org2016-02-282016-03-1920
1379535policy namespace stackinglinuxtim.gardner@canonical.com2014-10-092016-04-11550
1556264[Hyper-V] vmbus: Fix a bug in hv_need_to_signal_on_read()linuxtim.gardner@canonical.com2016-03-112016-03-2110
1557001Xilinx KU3 Capi card does not show up in Ubuntu 16.04linuxtim.gardner@canonical.com2016-03-142016-03-217
1557250linux fails to load x.509 built-in certificatelinuxtim.gardner@canonical.com2016-03-152016-03-216
1557689s390/kconfig: disable CONFIG_VIRTIO_MMIOlinuxtim.gardner@canonical.com2016-03-152016-03-216
1557690s390/kconfig: CONFIG_NUMA without CONFIG_NUMA_EMU does not make any sense on s390xlinuxtim.gardner@canonical.com2016-03-152016-03-2914
1557950mlx5_core kernel trace after "ethtool -C eth1 adaptive-rx on" flowlinuxtim.gardner@canonical.com2016-03-162016-03-215
1557994s390/kconfig: setting for CONFIG...9P....linuxtim.gardner@canonical.com2016-03-162016-03-215
1558025skb_warn_bad_offload Crashlinuxtim.gardner@canonical.com2016-03-162016-03-215
1558330Xenial update to v4.4.6 stable releaselinuxtim.gardner@canonical.com2016-03-172016-03-214
1558342Add PCIe root complex to Cavium arm64linuxtim.gardner@canonical.com2016-03-172016-03-214
1558447vivid/linux: total ADT test failureslinuxtim.gardner@canonical.com2016-03-172016-03-214
1558553IMA-appraisal is unusable in Ubuntu 16.04linuxtim.gardner@canonical.com2016-03-172016-03-214
1558624s390/pci: backport upstream commits since v4.4linuxtim.gardner@canonical.com2016-03-172016-03-214
1558625s390/pci: enforce fmb page boundary rulelinuxtim.gardner@canonical.com2016-03-172016-03-214
1558720[Hyper-V] patches to allow kdump crash through NMIlinuxtim.gardner@canonical.com2016-03-172016-03-214
1558765Add arm64 NUMA supportlinuxtim.gardner@canonical.com2016-03-172016-03-214
1559252linux: 4.4.0-15.31 -proposed trackerlinuxtim.gardner@canonical.com2016-03-182016-03-213
1394929[FFe]Please provide 'locales-all' as in Debianglibcadconrad@ubuntu.com2014-11-212016-03-21486
1497473[FFe] update glibc to 2.22 in wilyglibcadconrad@ubuntu.com2015-09-182016-03-21185
1521172[FFe][Ubuntu 16.04] Use glibc-2.23 in Ubuntu 16.04glibcadconrad@ubuntu.com2015-11-302016-03-21112
1525281The user should be prompted to install language packs needed for their selected language(s) which are not currently installedgnome-control-centertim@feathertop.org2015-12-112016-03-20100
1556693"intall" typo in cc-common-language.c - patchgnome-control-centertim@feathertop.org2016-03-132016-03-207
1559578fwupdate-signed: arch-qualified package names, but not coinstallablefwupdate-signedmario_limonciello@dell.com2016-03-192016-03-212
1559538[FFe] Update to latest upstream versionkdeconnect-plasmaclivejo@aol.com2016-03-192016-03-201
1557349Parole does not hold the media frame when paused in fullscreen modeparolesmd.seandavis@gmail.com2016-03-152016-03-216
1559243Missing string translations for Ubuntu MATE flavour.gfxboot-theme-ubuntucjwatson@ubuntu.com2016-03-182016-03-213
1550539VMWare network interface name change with wily → xenial upgradesystemdmartin.pitt@ubuntu.com2016-02-262016-03-2326
1554861Systemd crashes with a simple set of target unitssystemdmartin.pitt@ubuntu.com2016-03-092016-03-2314
1559038timespec parsing is wrongsystemdmartin.pitt@ubuntu.com2016-03-182016-03-235
1558263grub-install / powerpc-ibm-utils ofpathname does not support NVMe adapterspowerpc-ibm-utilsmathieu-tl@ubuntu.com2016-03-162016-03-215
1490618Ship qtdeclarative5-xmllistmodel-plugin and libqt5qml-graphicaleffects by defaultkubuntu-metayofel@kubuntu.org2015-08-312016-03-21203
1558135Update firmware lists for udebslinux-firmwareseth.forshee@canonical.com2016-03-162016-03-215
1212835Missing icon from dock and dashtransmissioniain@orangesquash.org.uk2013-08-152016-03-21949
1549456multipath discovery failed during install due to missing udev properties defined by sg3-utils udev ruleshw-detectmathieu-tl@ubuntu.com2016-02-242016-03-2126
1549504multipath discovery failed during install due to LVM volumes locking individual pathshw-detectmathieu-tl@ubuntu.com2016-02-242016-03-2126
1549506multipath discovery failed during install due to md arrays locking individual pathshw-detectmathieu-tl@ubuntu.com2016-02-242016-03-2126
1560008Please merge mksh 52c-1 (main) from Debian testing (main)mkshtg@mirbsd.de2016-03-212016-03-210
1560211execv failed: Operation not permittedubuntu-core-launcherjamie@ubuntu.com2016-03-212016-03-210
1560216warning: "UTS_UBUNTU_RELEASE_ABI" is not defined [-Wundef] UTS_UBUNTU_RELEASE_ABI >= 7 )kpatchchris.j.arges@canonical.com2016-03-212016-03-210
1559761Please merge final release matplotlib 1.5.1-1 (universe) from Debian testing (main)matplotlibbarry@ubuntu.com2016-03-202016-03-222
1462427test_fetch sporadic failurelandscape-clientandreas@canonical.com2015-06-052015-12-23201
1548946test failures on xenial: test_get_package_stanza and test_reload_channels_not_refetch_package_indexlandscape-clientandreas@canonical.com2016-02-232016-03-2127
1551892test failures on Xenial with transport headerslandscape-clientandreas@canonical.com2016-03-012016-03-1413
1557502Stop building landscape-client-ui and landscape-client-ui-install packageslandscape-clientandreas@canonical.com2016-03-152016-03-216
1528583[FFe] Please update to MySQL 5.7 seriesmysql-5.7robie.basak@ubuntu.com2015-12-222016-04-25125
1545071missing installed examples tests snapcraftsergio.schvezov@ubuntu.com2016-02-122016-03-2239
1552168Add a kernel pluginsnapcraftsergio.schvezov@ubuntu.com2016-03-022016-03-2220
1554565Since 16.04 no PPA requiredsnapcraftsergio.schvezov@ubuntu.com2016-03-082016-03-2214
1555386travis jobs fail with a timeout after more than 45 minutes executingsnapcraftsergio.schvezov@ubuntu.com2016-03-102016-03-2818
1555733unicode characters break help outputsnapcraftsergio.schvezov@ubuntu.com2016-03-102016-03-2212
1558446Pulling local sources is rather brokensnapcraftsergio.schvezov@ubuntu.com2016-03-172016-03-225
1558623Add a kbuild pluginsnapcraftsergio.schvezov@ubuntu.com2016-03-172016-03-225
1558810Snapcraft needs better state trackingsnapcraftsergio.schvezov@ubuntu.com2016-03-172016-03-225
1558970Support downloading snapssnapcraftsergio.schvezov@ubuntu.com2016-03-182016-03-224
1560158Migrate old Snapcraft state tracking to newsnapcraftsergio.schvezov@ubuntu.com2016-03-212016-03-221
1560120Unprivileged nested container will not start inside a privileged containerlxcfsserge.hallyn@ubuntu.com2016-03-222016-03-220
1523255click-review return code doesn't distinguish Warnings from Errorsclick-reviewers-toolsjamie@ubuntu.com2015-12-062016-03-22107
1557126remove support for frameworks from snapv2 (16.04)click-reviewers-toolsjamie@ubuntu.com2016-03-142016-03-228
1559540Doctrine updates for php7.0 compatibilityphp-doctrine-dbalnish.aravamudan@canonical.com2016-03-222016-03-220
1480363GCC is not installed by default in Kubuntukubuntu-metayofel@kubuntu.org2015-07-312016-03-22235
1547033make snappy's /etc/mtab symlink agree to tmpfiles.d/debian.conflivecd-rootfsogra@ubuntu.com2016-03-252016-03-250
1518885STC840:Tuleta-L:PNV:njp01:Ubuntu:Attempting to format a drive in JBOD format to RAID format segmentation faults.iprutilssteve.langasek@ubuntu.com2015-11-232016-03-22120
1560709Please sync cakephp 2.8.0-1 from Debian unstablezonemindernish.aravamudan@canonical.com2016-03-222016-03-231
1547183Remove php5 specific packages from the archiveicinga-webnish.aravamudan@canonical.com2016-03-222016-03-231
1544352[PHP7] After bootstrapping, these PHP packages can be rebuilticingaweb2nish.aravamudan@canonical.com2016-03-232016-03-230
1560777Needs libgnutls-deb0.so.28 but it doesn't existhaskell-gnutlsrobie.basak@ubuntu.com2016-03-232016-03-230
1556516passwd and group entries are not removed on logout from a guest sessionlightdmrobert.ancell@canonical.com2016-03-132016-03-2310
1543230After installing freeipa-server-trust-ad ipa tries to start smb.service which doesn't existfreeipatjaalton@debian.org2016-02-082016-04-1971
1560208Keyboard short cuts for enabling/disabling the screen reader are missing ubuntu-mate-welcomecode@flexion.org2016-03-212016-03-232
1560493username-welcome crashed with TypeError in _check_arg_types(): join() argument must be str or bytes, not 'NoneType'ubuntu-mate-welcomecode@flexion.org2016-03-222016-03-231
1560764"fails to request state" when trying to perform actions in mokutilmokutilmario_limonciello@dell.com2016-03-232016-03-252
1429198tightvncserver crashes at startup on arm64tightvncdannf@ubuntu.com2015-03-062016-03-23383
1538615Cat causes login screen to hangunity-greeterrobert.ancell@canonical.com2016-03-242016-03-251
1537786lifecycle: allow do clean rebuild of all/parts without having to pull all againsnapcraftsergio.schvezov@ubuntu.com2016-01-252016-03-2459
1557513please add option to override -all-root in "snapcraft snap"snapcraftsergio.schvezov@ubuntu.com2016-03-152016-03-249
1558965Snap building fails due to missing include directorysnapcraftsergio.schvezov@ubuntu.com2016-03-182016-03-246
1560254test_libpipeline example fails with /snaps/bin/pipelinetest.pipelinetest: No such file or directorysnapcraftsergio.schvezov@ubuntu.com2016-03-212016-03-243
1560255test_busybox example fails because the /snaps/bin/busybox.ls now returns the cwd contentssnapcraftsergio.schvezov@ubuntu.com2016-03-212016-03-243
1560481snapcraft prints 'architectures' when trying to build a gadget snapsnapcraftsergio.schvezov@ubuntu.com2016-03-222016-03-242
1560586busybox is missing a gcc build-packages entrysnapcraftsergio.schvezov@ubuntu.com2016-03-222016-03-242
1561546Snapcraft clean removes local pluginssnapcraftkyle@canonical.com2016-03-242016-03-240
1509829lightdm-guest-session profile is too strict to input Japanese text with fcitx-mozcfcitxhappyaron@ubuntu.com2016-03-172016-03-258
1556241installer sets "iface encf5f0 inet dhcp" although a static IP address was preseededubuntu-snappymichael.vogt@ubuntu.com2016-03-232016-03-252
1560162Xenial: scaling is horribly out on xps13 install sessionmetacityiain@orangesquash.org.uk2016-03-242016-03-251
1560752File mode incorrectly assigned for devicelxdstgraber@ubuntu.com2016-03-232016-03-252
12598615-10 second delay in kernel boot with kernel command line ip=linuxtim.gardner@canonical.com2013-12-112016-03-29839
1505948Memory arena corruption with FUSE (was Memory allocation failure crashes kernel hard, presumably related to FUSE)linuxtim.gardner@canonical.com2015-10-142016-03-29167
1519814spl/zfs fails to build on s390xlinuxtim.gardner@canonical.com2015-11-252016-03-29125
1553811Thinkpad T460: Trackpoint mouse buttons instantly generate "release" event on presslinuxtim.gardner@canonical.com2016-03-062016-03-2923
1558828Need enough contiguous memory to support GICv3 ITS tablelinuxtim.gardner@canonical.com2016-03-172016-03-2912
1558871zfs: enable zfs for 64bit powerpc kernelslinuxtim.gardner@canonical.com2016-03-182016-03-2911
1559349PMU support for Cavium ThunderXlinuxtim.gardner@canonical.com2016-03-182016-03-2911
1559350Show ARM PMU events in perf statlinuxtim.gardner@canonical.com2016-03-182016-03-2911
1559609arcmsr times out with ARC1882 RAID cardlinuxtim.gardner@canonical.com2016-03-202016-03-299
1559692server image has no keyboard, desktop image workslinuxtim.gardner@canonical.com2016-03-202016-03-299
1559904[Bug]HSW/BDW EDAC driver reports wrong DIMMlinuxtim.gardner@canonical.com2016-03-212016-03-298
1560445linux packaging: clear remaining redundant deltalinuxtim.gardner@canonical.com2016-03-222016-03-286
1560489cgroup namespaces: add a 'nsroot=' mountinfo fieldlinuxtim.gardner@canonical.com2016-03-222016-03-297
1560583reading /sys/kernel/security/apparmor/profiles requires CAP_MAC_ADMINlinuxtim.gardner@canonical.com2016-03-222016-03-297
1561483linux: sync to ZFS 0.6.5.6 stable releaselinuxtim.gardner@canonical.com2016-03-242016-03-295
1561492linux: sync virtualbox drivers to 5.0.16-dfsg-2linuxtim.gardner@canonical.com2016-03-242016-03-295
1561676fix thermal throttling due to commit "Thermal: initialize thermal zone device correctly" linuxtim.gardner@canonical.com2016-03-242016-03-295
1561727linux: 4.4.0-16.32 -proposed trackerlinuxtim.gardner@canonical.com2016-03-242016-03-295
1562090Update to PHP7.0 dependenciesphp-horde-passwdnish.aravamudan@canonical.com2016-03-252016-03-250
1562136Update to PHP7.0 dependenciesmlmmjnish.aravamudan@canonical.com2016-03-252016-03-250
1538471scope-runner-dbus.py assert failure: *** Error in `/usr/bin/python3': free(): invalid next size (fast): 0x0000000001ca17b0 ***pygobjectiain@orangesquash.org.uk2016-03-232016-03-263
1562133Update to PHP7.0 dependenciesmimedefangnish.aravamudan@canonical.com2016-03-252016-03-250
1562128Update to PHP7.0 dependenciesmagpierssnish.aravamudan@canonical.com2016-03-252016-03-250
1562082Update to PHP7.0 dependenciesphp-horde-kolab-servernish.aravamudan@canonical.com2016-03-252016-03-250
1562051update to PHP7.0 dependenciesphp-horde-activesyncnish.aravamudan@canonical.com2016-03-252016-03-261
1562074Update to PHP7.0 dependenciesphp-horde-ingonish.aravamudan@canonical.com2016-03-252016-03-261
1562078Update to PHP7.0 dependenciesphp-horde-cryptnish.aravamudan@canonical.com2016-03-252016-03-305
1562192Update to PHP7.0 dependenciesnetmrgnish.aravamudan@canonical.com2016-03-252016-04-0713
1562195Update to PHP7.0 dependenciesnordugrid-arcnish.aravamudan@canonical.com2016-03-252016-03-261
1562196Update to PHP7.0 dependenciesnusoapnish.aravamudan@canonical.com2016-03-252016-03-261
1562201Update to PHP7.0 dependenciesnagvisnish.aravamudan@canonical.com2016-03-252016-03-261
1562212Update to PHP7.0 dependenciesocsinventory-servernish.aravamudan@canonical.com2016-03-252016-03-261
1560099cups-browsed generates constant and significant network trafficcups-filterstill.kamppeter@gmail.com2016-03-212016-03-265
1552983Please merge logwatch 7.4.2-1 from Debianlogwatchnish.aravamudan@canonical.com2016-03-042016-03-2622
1540407multipathd drops paths of a temporarily lost devicemultipath-toolsryan.harper@canonical.com2016-02-012016-03-2755
1551952FFE: Please merge multipath-tools 0.5.0+git1.656f8865 from Debian unstable multipath-toolsryan.harper@canonical.com2016-03-012016-03-2726
1562118.temp/dists/.../Packages goes out of datedebmirrorcjwatson@ubuntu.com2016-03-252016-03-272
1562942Update to PHP7.0 dependenciespgsnapnish.aravamudan@canonical.com2016-03-282016-03-280
1562952Update to PHP7.0 dependenciesphoronix-test-suitenish.aravamudan@canonical.com2016-03-282016-03-280
1562950Update to PHP7.0 dependenciesphammnish.aravamudan@canonical.com2016-03-282016-03-280
1562940Update to PHP7.0 dependenciespgfouinenish.aravamudan@canonical.com2016-03-282016-03-280
1562962Update to PHP7.0 dependenciesphp-arcnish.aravamudan@canonical.com2016-03-282016-03-280
1562979Update to PHP7.0 dependenciesphp-casnish.aravamudan@canonical.com2016-03-282016-03-280
1562977Update to PHP7.0 dependenciesphp-cachenish.aravamudan@canonical.com2016-03-282016-03-280
1562215Update to PHP7.0 dependenciesowfsnish.aravamudan@canonical.com2016-03-262016-03-282
1562921Please sync php-mongodb from Debian gitphp-mongodbsteve.langasek@ubuntu.com2016-03-282016-03-280
1563047Update for PHP7.0php-crypt-blowfishnish.aravamudan@canonical.com2016-03-282016-03-302
1563066Update to PHP7.0 dependenciesphp-fxslnish.aravamudan@canonical.com2016-03-282016-03-291
1563059Add php-mbstring as dependency in PHP7php-crypt-gpgnish.aravamudan@canonical.com2016-03-282016-03-291
1563061Update to PHP7.0 depedenciesphp-fpdfnish.aravamudan@canonical.com2016-03-282016-03-280
1563132Update to PHP7.0 dependenciesphp-horde-constraintnish.aravamudan@canonical.com2016-03-292016-03-290
1563129Update to PHP7.0 dependenciesphp-horde-compressnish.aravamudan@canonical.com2016-03-292016-03-290
1563125Update to PHP7.0 dependenciesphp-horde-autoloadernish.aravamudan@canonical.com2016-03-292016-03-290
1563130Update to PHP7.0 dependenciesphp-horde-compress-fastnish.aravamudan@canonical.com2016-03-292016-03-290
1563123Update to PHP7.0 dependenciesphp-horde-authnish.aravamudan@canonical.com2016-03-292016-03-290
1563118Update to PHP7.0 dependenciesphp-horde-alarmnish.aravamudan@canonical.com2016-03-282016-03-291
1563120Update to PHP7.0 dependenciesphp-horde-argvnish.aravamudan@canonical.com2016-03-292016-03-290
1563116Fix hexadecimal string handling in PHP7.0php-hamcrestnish.aravamudan@canonical.com2016-03-282016-03-291
1563081Port to PHP7.0php-gnupgnish.aravamudan@canonical.com2016-03-282016-03-291
1562512jayatana still depends on openjdk-7jayatanasteve.langasek@ubuntu.com2016-03-272016-03-292
1563036libaudit & plymouth only available on Linuxlightdmrobert.ancell@canonical.com2016-03-282016-03-291
1556383please merge remmina from debianremminalocutusofborg@debian.org2016-03-122016-03-2917
1561271updated s390x port, strip binariesgolang-1.6michael.hudson@canonical.com2016-03-242016-03-295
1561343start stripping binariesgolang-1.6michael.hudson@canonical.com2016-03-242016-03-295
1559449AppStream icon for scummvm.desktopscummvmrobert.ancell@canonical.com2016-03-192016-03-2910
1553212ubuntuone login keyboard navigation small issuesgnome-softwarerobert.ancell@canonical.com2016-03-042016-03-2925
1508865oem-config: networking not enabled during user configubiquitymathieu-tl@ubuntu.com2015-10-222016-03-29159
1552621Can't login to desktop autometically after oem-config is finished on OEM modeubiquitymathieu-tl@ubuntu.com2016-03-032016-03-2926
1554009use after free and mem leak in lpm6dpdkchristian.ehrhardt@canonical.com2016-03-072016-03-2922
1557532dpdk fails to use 1G huge pages depending on the available mountpointsdpdkchristian.ehrhardt@canonical.com2016-03-152016-03-2914
1558485init script can fail when devices are unassigneddpdkchristian.ehrhardt@canonical.com2016-03-172016-03-2912
1559981dpdk stability improvements by cherry picking from 16.04-rc1dpdkchristian.ehrhardt@canonical.com2016-03-212016-03-298
1560839libdpdk0 should provide a package for debug symbolsdpdkchristian.ehrhardt@canonical.com2016-03-232016-03-296
1562872Welcome wizard does not successfully set nameshadowmterry@ubuntu.com2016-03-282016-03-291
1562989'aa_change_onexec failed with -1. errmsg: Permission denied'ubuntu-core-launcherjamie@ubuntu.com2016-03-282016-03-291
1562827Global symbol "$subdir" requires explicit package name at /usr/bin/debmirror line ...debmirrorcjwatson@ubuntu.com2016-03-282016-03-291
1534263[FFe] [merge request] Import cmake-3.5 series to Ubuntu Xenial 16.04LTScmakejrivero@osrfoundation.org2016-01-142016-03-2975
1562784cloud-init 0.7.7~bzr1189-0ubuntu1kills snappy boot ubuntu-core-configogra@ubuntu.com2016-03-292016-03-290
1563482Update to PHP7.0 dependenciesphp-horde-mimenish.aravamudan@canonical.com2016-03-292016-03-290
1563479Update to PHP7.0 dependenciesphp-horde-mail-autoconfignish.aravamudan@canonical.com2016-03-292016-03-290
1563478Update to PHP7.0 dependenciesphp-horde-mailnish.aravamudan@canonical.com2016-03-292016-03-290
1563475Update to PHP7.0 dependenciesphp-horde-lz4nish.aravamudan@canonical.com2016-03-292016-03-290
1563474Update to PHP7.0 dependenciesphp-horde-logintasksnish.aravamudan@canonical.com2016-03-292016-03-290
1563471Update to PHP7.0 dependenciesphp-horde-locknish.aravamudan@canonical.com2016-03-292016-03-290
1563468Update to PHP7.0 dependenciesphp-horde-listheadersnish.aravamudan@canonical.com2016-03-292016-03-290
1563472Update to PHP7.0 dependenciesphp-horde-lognish.aravamudan@canonical.com2016-03-292016-03-290
1563466Update to PHP7.0 dependenciesphp-horde-ldapnish.aravamudan@canonical.com2016-03-292016-03-290
1563461Update to PHP7.0 dependenciesphp-horde-kolab-sessionnish.aravamudan@canonical.com2016-03-292016-03-290
1563456Update to PHP7.0 dependenciesphp-horde-kolab-formatnish.aravamudan@canonical.com2016-03-292016-03-290
1563451Update to PHP7.0 dependenciesphp-horde-itipnish.aravamudan@canonical.com2016-03-292016-03-290
1563449Update to PHP7.0 dependenciesphp-horde-injectornish.aravamudan@canonical.com2016-03-292016-03-290
1563442Update to PHP7.0 dependenciesphp-horde-httpnish.aravamudan@canonical.com2016-03-292016-03-301
1563447Update to PHP7.0 dependenciesphp-horde-icalendarnish.aravamudan@canonical.com2016-03-292016-03-290
1563438Update to PHP7.0 dependenciesphp-horde-historynish.aravamudan@canonical.com2016-03-292016-03-290
1563436Update to PHP7.0 dependenciesphp-horde-hashtablenish.aravamudan@canonical.com2016-03-292016-03-290
1563433Update to PHP7.0 dependenciesphp-horde-groupnish.aravamudan@canonical.com2016-03-292016-03-290
1563429Update to PHP7.0 dependenciesphp-horde-exceptionnish.aravamudan@canonical.com2016-03-292016-03-301
1563431Update to PHP7.0 dependenciesphp-horde-feednish.aravamudan@canonical.com2016-03-292016-03-290
1563425Update to PHP7.0 dependenciesphp-horde-dbnish.aravamudan@canonical.com2016-03-292016-03-290
1563422Update to PHP7.0 dependenciesphp-horde-date-parsernish.aravamudan@canonical.com2016-03-292016-03-290
1563417Update to PHP7.0 dependenciesphp-horde-datenish.aravamudan@canonical.com2016-03-292016-03-301
1563414Update to PHP7.0 dependenciesphp-horde-datanish.aravamudan@canonical.com2016-03-292016-03-290
1563408Update to PHP7.0 dependenciesphp-horde-crypt-blowfishnish.aravamudan@canonical.com2016-03-292016-03-290
1563411Update to PHP7.0 dependenciesphp-horde-css-parsernish.aravamudan@canonical.com2016-03-292016-03-290
1563406Update to PHP7.0 dependenciesphp-horde-corenish.aravamudan@canonical.com2016-03-292016-03-290
1563403Update to PHP7.0 dependenciesphp-horde-controllernish.aravamudan@canonical.com2016-03-292016-03-290
1563085Sync php-guzzlehttp-ringphp 1.1.0-2 (universe) from Debian unstable (main)php-guzzlehttp-ringphpnish.aravamudan@canonical.com2016-03-282016-03-291
1563098Update d/rules UPSTREAM regexphp-apigennish.aravamudan@canonical.com2016-03-282016-03-291
1563548CMake 3.5's pkg-config support brokencmakelocutusofborg@debian.org2016-03-292016-03-301
1562210Update to PHP7.0 dependenciesoarnish.aravamudan@canonical.com2016-03-252016-03-305
1535112moving KDE apps with menu bar click can cause an unrecoverable freezexfwm4unit193@ubuntu.com2016-01-172016-03-3073
1563557.mo files for Contacts are not included in langpacksgnome-contactstim@feathertop.org2016-03-292016-03-301
1563580please merge cmake from debiancmakelocutusofborg@debian.org2016-03-292016-03-301
1562756Update ubuntu-mate-meta to fix dependency issueubuntu-mate-metatimo-jyrinki@ubuntu.com2016-03-282016-03-302
1563973Update to PHP7.0 dependenciesphp-horde-mnemonish.aravamudan@canonical.com2016-03-302016-03-300
1563983Update to PHP7.0 dependenciesphp-horde-secretnish.aravamudan@canonical.com2016-03-302016-03-300
1563984Update to PHP7.0 dependenciesphp-horde-service-gravatarnish.aravamudan@canonical.com2016-03-302016-03-300
1563978Update to PHP7.0 dependenciesphp-horde-permsnish.aravamudan@canonical.com2016-03-302016-03-300
1563979Update to PHP7.0 dependenciesphp-horde-rdonish.aravamudan@canonical.com2016-03-302016-03-300
1563980Update to PHP7.0 dependenciesphp-horde-routesnish.aravamudan@canonical.com2016-03-302016-03-300
1563974Update to PHP7.0 dependenciesphp-horde-nagnish.aravamudan@canonical.com2016-03-302016-03-300
1563976Update to PHP7.0 dependenciesphp-horde-pdfnish.aravamudan@canonical.com2016-03-302016-03-300
1563825FFe: Update to sudo 1.8.16sudomarc.deslauriers@ubuntu.com2016-03-302016-03-300
1555700Please merge tgt 1.0.63 from Debian (unstable)tgtryan.harper@canonical.com2016-03-102016-03-3020
1562184Update to PHP7.0 dependenciesmythtvsteve.langasek@ubuntu.com2016-03-252016-04-0713
1563686package foomatic-filters-beh (not installed) failed to install/upgrade: trying to overwrite '/usr/lib/cups/backend/beh', which is also in package cups-filters 1.8.3-2ubuntu1cups-filterstill.kamppeter@gmail.com2016-03-302016-03-311
1560710ISST-SAN:KVM:R3-0: LVM udev rules deadlock with large number of PVslvm2martin.pitt@ubuntu.com2016-03-292016-03-301
1553943gcc-5 binaries are not stripped in Xenialgcc-5doko@ubuntu.com2016-03-072016-04-0125
1563514[util-linux] lscpu: Fix model and model name on Power Systemsutil-linuxmartin.pitt@ubuntu.com2016-03-292016-03-312
1564093Update to PHP7.0 dependenciesphp-horde-urlnish.aravamudan@canonical.com2016-03-302016-03-311
1564094Update to PHP7.0 dependenciesphp-horde-vfsnish.aravamudan@canonical.com2016-03-302016-03-311
1564096Update to PHP7.0 dependenciesphp-horde-wickednish.aravamudan@canonical.com2016-03-302016-03-311
1564097Update to PHP7.0 dependenciesphp-horde-xml-elementnish.aravamudan@canonical.com2016-03-302016-03-311
1564098Update to PHP7.0 dependenciesphp-horde-xml-wbxmlnish.aravamudan@canonical.com2016-03-302016-03-311
1564020Update to PHP7.0 dependenciesphp-horde-seshanish.aravamudan@canonical.com2016-03-302016-03-300
1564051Update to PHP7.0 dependenciesphp-horde-translationnish.aravamudan@canonical.com2016-03-302016-03-311
1564050Update to PHP7.0 dependenciesphp-horde-tokennish.aravamudan@canonical.com2016-03-302016-03-311
1564048Update to PHP7.0 dependenciesphp-horde-timezonenish.aravamudan@canonical.com2016-03-302016-03-311
1564047Update to PHP7.0 dependenciesphp-horde-text-flowednish.aravamudan@canonical.com2016-03-302016-03-311
1564040Update to PHP7.0 dependenciesphp-horde-text-filternish.aravamudan@canonical.com2016-03-302016-03-311
1564037Update to PHP7.0 dependenciesphp-horde-text-diffnish.aravamudan@canonical.com2016-03-302016-03-311
1564035Update to PHP7.0 dependenciesphp-horde-supportnish.aravamudan@canonical.com2016-03-302016-03-311
1564033Update to PHP7.0 dependenciesphp-horde-stream-wrappernish.aravamudan@canonical.com2016-03-302016-03-311
1564036Update to PHP7.0 dependenciesphp-horde-templatenish.aravamudan@canonical.com2016-03-302016-03-311
1564030Update to PHP7.0 dependenciesphp-horde-stream-filternish.aravamudan@canonical.com2016-03-302016-03-311
1564029Update to PHP7.0 dependenciesphp-horde-streamnish.aravamudan@canonical.com2016-03-302016-03-311
1564027Update to PHP7.0 dependenciesphp-horde-spellcheckernish.aravamudan@canonical.com2016-03-302016-03-311
1564024Update to PHP7.0 dependenciesphp-horde-smtpnish.aravamudan@canonical.com2016-03-302016-03-311
1564022Update to PHP7.0 dependenciesphp-horde-sharenish.aravamudan@canonical.com2016-03-302016-03-311
1564124puts 'golang-defaults' in built-using, not golang-1.6dh-golangmichael.hudson@canonical.com2016-03-302016-03-311
1564056Update to PHP7.0 dependenciesphp-horde-sessionhandlernish.aravamudan@canonical.com2016-03-302016-03-311
1564002Update to PHP7.0 dependenciesphp-horde-service-weathernish.aravamudan@canonical.com2016-03-302016-03-311
1507232Mangler mangling hostname/port information in wilymanglerstevenk@ubuntu.com2015-10-182016-03-31165
1564169Update to PHP7.0 dependenciesphpmyadminnish.aravamudan@canonical.com2016-03-312016-03-310
1564136Update to PHP7.0 dependenciesphp-mdb2-driver-mysqlnish.aravamudan@canonical.com2016-03-302016-03-311
1564138Update to PHP7.0 dependenciesphp-mdb2-driver-pgsqlnish.aravamudan@canonical.com2016-03-302016-03-311
1564112Update to PHP7.0 dependenciesphp-irodsnish.aravamudan@canonical.com2016-03-302016-03-311
1533206Blueman-applet crash on login: DBusException in call_blocking(): org.freedesktop.DBus.Error.TimedOut: Failed to activate service 'org.bluez': timed outbluemansmd.seandavis@gmail.com2016-01-122016-03-3179
1559187dasd-config: allow users to re-format DASDs in non-expert modes390-dasdxnox@ubuntu.com2016-03-182016-03-3113
1564234gpgme1.0 doesn't work properly with gnupg 2.0gnupg2mario_limonciello@dell.com2016-03-312016-03-310
1559193disk-detect/s390-dasd/s390-zfcp: Restructure installer and put DASD and FCP configuration into disk detections390-zfcpxnox@ubuntu.com2016-03-182016-04-0417
1561658ppc64el ubuntu-server ISO does not install libpam-systemdubuntu-metamartin.pitt@ubuntu.com2016-03-242016-03-317
1519625[Feature]Always Running Timer (ART) to System Time translation linuxtim.gardner@canonical.com2016-03-262016-04-0510
1520139[Feature] Enable I2C on Broxton-Plinuxtim.gardner@canonical.com2016-03-252016-04-0511
1534216lots of printk to serial console can hang system for long timelinuxtim.gardner@canonical.com2016-01-142016-04-0582
1541585[Hyper-V] Hyper-V Socketslinuxtim.gardner@canonical.com2016-02-032016-04-0562
1559914[Bug]Disable multi-record PEBS on Meromlinuxtim.gardner@canonical.com2016-03-252016-04-0511
1559918[Bug]SKL-H boot hang when c8+c9+c10 enabled by intel_idle driverlinuxtim.gardner@canonical.com2016-03-282016-04-058
1560395[i915_bpo] Update i915 backport driverlinuxtim.gardner@canonical.com2016-03-222016-04-0514
1560514Predictable naming mechanism is leading to issues in DLPAR operations of NICslinuxtim.gardner@canonical.com2016-03-222016-04-0514
1560552ISST-LTE: pVM:high cpus number need a high crashkernel value in kdumplinuxtim.gardner@canonical.com2016-03-222016-04-0514
1561604x-gene2: add SoC v2 support to clocklinuxtim.gardner@canonical.com2016-03-242016-04-0512
1562310Bring fm10k up to Fortville SW5linuxtim.gardner@canonical.com2016-03-262016-04-0510
1562326ixgbe: Update to Fortville SW5 releaselinuxtim.gardner@canonical.com2016-03-262016-04-0510
1562968ThunderX: support alternative phy implementationslinuxtim.gardner@canonical.com2016-03-282016-04-058
1563293linux: exclude ZONE_DEVICE from GFP_ZONE_TABLElinuxtim.gardner@canonical.com2016-03-292016-04-057
1563441linux: 4.4.0-17.33 -proposed trackerlinuxtim.gardner@canonical.com2016-03-292016-04-057
1564187issue with conditional in postinstcloud-initsmoser@ubuntu.com2016-03-312016-03-310
1541955installer/netcfg gives misleading error message when parsing line with trailing blanksnetcfgxnox@ubuntu.com2016-02-052016-03-3155
1564492FTBFS: php-mf2 due to unicode in substvars filedebhelpernish.aravamudan@canonical.com2016-03-312016-04-011
1556671[xenial] virt-install aborts with ImportError: No module named ipaddrvirt-managermarc.deslauriers@ubuntu.com2016-03-132016-03-3118
1553040systemd-logind crashed with SIGSEGVsystemdmartin.pitt@ubuntu.com2016-03-042016-04-0128
1555237Upgrade from 14.04.4→ 16.04 dies midway taking out the session.systemdmartin.pitt@ubuntu.com2016-03-312016-04-011
1560112 /var/lib/dpkg/info/udev.postinst: 109: [: Illegal number: *systemdmartin.pitt@ubuntu.com2016-03-212016-04-0111
1560695Assertion 'b' failed at ../src/basic/path-util.c:390, function path_compare()systemdmartin.pitt@ubuntu.com2016-03-222016-04-0110
989819Make duplicate signature more specific for DBusException and OSErrorapportmartin.pitt@ubuntu.com2012-08-102016-03-311329
1564637Update to PHP7.0 dependenciesphp-picofeednish.aravamudan@canonical.com2016-03-312016-04-011
1564569Update to PHP7.0 dependenciesphppgadminnish.aravamudan@canonical.com2016-03-312016-04-011
1564552Update to PHP7.0 dependenciesphp-pclzipnish.aravamudan@canonical.com2016-03-312016-04-011
1564548Update to PHP7.0 dependenciesphp-parsernish.aravamudan@canonical.com2016-03-312016-04-011
1564546Update to PHP7.0 dependenciesphp-openidnish.aravamudan@canonical.com2016-03-312016-04-011
1564521Update to PHP7.0 dependenciesphp-net-publicsuffixnish.aravamudan@canonical.com2016-03-312016-04-011
1564509Update to PHP7.0 dependenciesphp-net-ldapnish.aravamudan@canonical.com2016-03-312016-04-011
1564121Update to PHP7.0 dependenciesphpldapadminnish.aravamudan@canonical.com2016-03-302016-04-012
1304920mugshot crashed with ValueError in init_user_details(): need more than 1 value to unpackmugshotsmd.seandavis@gmail.com2014-04-092016-04-01723
1394064Mugshot fails to launch after clearing all user info fields (name, initials, email, etc)mugshotsmd.seandavis@gmail.com2014-11-192016-04-01499
1400055mugshot crashes_.face emptymugshotsmd.seandavis@gmail.com2014-12-072016-04-01481
1557744mugshot crashed with PermissionError in get_libreoffice_data(): [Errno 13] Permission denied: '/home/username/.config/libreoffice/4/user/registrymodifications.xcu'mugshotsmd.seandavis@gmail.com2016-03-152016-04-0117
1559815shows no first name as Unknown and no intials as Umugshotsmd.seandavis@gmail.com2016-03-212016-04-0111
1560685docker: Error response from daemon: error creating aufs mountdocker.ioserge.hallyn@ubuntu.com2016-03-222016-04-0413
1564566[FFe] Update to PHP7.0 upstream versionsphp-propronish.aravamudan@canonical.com2016-03-312016-04-022
1563553Translations not loading in Gnome Calendar 3.19.92-0ubuntu2gnome-calendargunnarhj@ubuntu.com2016-03-292016-04-013
1548009[FFe] ZFS pools should be automatically scrubbedzfs-linuxcolin.king@canonical.com2016-02-212016-04-0847
1547608Notifications use actions which are not appropriate in notify-osdgnome-softwarewilliam.hua@canonical.com2016-02-192016-04-0142
1557329Installation with btrfs ends in "initramfs" after final installation-rebootzipl-installerxnox@ubuntu.com2016-03-152016-04-0117
1563393[FFe] Update nginx to 1.9.13.nginxteward@ubuntu.com2016-03-292016-04-013
1565000[CVE-2013-7449] xchat and derivatives don't validate ssl hostnamesxchat-gnomemarc.deslauriers@ubuntu.com2016-04-012016-04-010
1564487ISST-LTE:pVM:thymelp2:ubuntu 16.04: cannot analyse vmcore with crash (s390x, ppc64)crashchris.j.arges@canonical.com2016-03-312016-04-011
1563296support cloud-init networking with snappylivecd-rootfsogra@ubuntu.com2016-03-302016-04-012
1565042Update to 0.7.0 releasefwupdmario_limonciello@dell.com2016-04-012016-04-010
1565037Update to PHP7.0 dependenciesphp-sepa-direct-debitnish.aravamudan@canonical.com2016-04-012016-04-010
1460602Erasing disk failed: Error wiping newly created partitionudisks2mathieu-tl@ubuntu.com2015-06-012016-04-04308
1565065Update to PHP7.0 dependenciesphp-text-captchanish.aravamudan@canonical.com2016-04-012016-04-010
1565073Update to PHP7.0 dependenciesphp-xajaxnish.aravamudan@canonical.com2016-04-012016-04-010
1565072Update to PHP7.0 dependenciesphpwebcounternish.aravamudan@canonical.com2016-04-012016-04-010
1556765Valgrind command valgrind /bin/true shows errorvalgrinddannf@ubuntu.com2016-03-142016-04-0118
1563420valgrind: Backport Valgrind patches for s390 to Ubuntu 16.04valgrinddannf@ubuntu.com2016-03-292016-04-1214
1565039Update to PHP7.0 dependenciesphp-services-weathernish.aravamudan@canonical.com2016-04-012016-04-010
1565021Update to PHP7.0 dependenciesphpreportsnish.aravamudan@canonical.com2016-04-012016-04-010
1565116Add build-dep on php-mbstring.php-sabre-vobject-3nish.aravamudan@canonical.com2016-04-012016-04-010
1564998Update to PHP7.0 dependenciesphpqrcodenish.aravamudan@canonical.com2016-04-012016-04-010
1564984Add php-pear as a run-time dependencyphp-net-ldap2nish.aravamudan@canonical.com2016-04-012016-04-010
1565091Update to PHP7.0 dependenciesphp-xml-parsernish.aravamudan@canonical.com2016-04-012016-04-021
1565099Update to PHP7.0 dependenciessbncnish.aravamudan@canonical.com2016-04-012016-04-021
1565098Update to PHP7.0 dependenciesrtguinish.aravamudan@canonical.com2016-04-012016-04-021
1565096Update to PHP7.0 dependenciespostfix-cluebringernish.aravamudan@canonical.com2016-04-012016-04-021
1565095Update to PHP7.0 dependenciespostfixadminnish.aravamudan@canonical.com2016-04-012016-04-021
1565093Update to PHP7.0 dependenciespluxmlnish.aravamudan@canonical.com2016-04-012016-04-021
1565092Update to PHP7.0 dependenciesphp-zipstreamernish.aravamudan@canonical.com2016-04-012016-04-021
1565045[FFe] Update to php-stomp 1.0.9php-stompnish.aravamudan@canonical.com2016-04-012016-04-021
1565025Update for PHP7.0 dependencies and syntaxphp-sabre-vobjectnish.aravamudan@canonical.com2016-04-012016-04-021
1565161Update to PHP7.0 dependenciessemanticscuttlenish.aravamudan@canonical.com2016-04-012016-04-021
1565160Update to PHP7.0 dependenciesserverstatsnish.aravamudan@canonical.com2016-04-012016-04-021
1565158Update to PHP7.0 dependenciessimpleid-ldapnish.aravamudan@canonical.com2016-04-012016-04-021
1565159Update to PHP7.0 dependenciesshaarlinish.aravamudan@canonical.com2016-04-012016-04-021
1565157Update to PHP7.0 dependenciessimpleidnish.aravamudan@canonical.com2016-04-012016-04-021
1565155Update to PHP7.0 dependenciesslbackup-phpnish.aravamudan@canonical.com2016-04-012016-04-021
1565156Update to PHP7.0 dependenciessimplepienish.aravamudan@canonical.com2016-04-012016-04-021
1565151Update to PHP7.0 dependenciessparkline-phpnish.aravamudan@canonical.com2016-04-012016-04-021
1565152Update to PHP7.0 dependenciessmarty-gettextnish.aravamudan@canonical.com2016-04-012016-04-021
1565154Update to PHP7.0 dependenciessmarty3nish.aravamudan@canonical.com2016-04-012016-04-021
1565150Update to PHP7.0 dependenciesspipnish.aravamudan@canonical.com2016-04-012016-04-021
1562172[FFe] Update to moodle 3.0.3moodlesteve.langasek@ubuntu.com2016-03-252016-04-028
1562287Julia FTBFS on armhf since 5.3.1-3ubuntu3, builds in Debianjuliaginggs@ubuntu.com2016-03-262016-04-0510
1495163Insecure use of system() allows arbitrary code execution via "Show in Folder"shuttera.starr.b@gmail.com2015-09-132016-04-02202
1564122Please update to bugfix release shutter 0.93.1-1 (universe) from Debian testing (main)shuttera.starr.b@gmail.com2016-03-302016-04-023
1557673systemtap does not work on xenial, struct module changessystemtapdan.streetman@canonical.com2016-03-152016-04-0218
1565114Test suite fails on s390x and powerpcfwupdmario_limonciello@dell.com2016-04-012016-04-032
1563089Memory Leak when new cluster configuration is formed.corosyncjorge.niedbalski@canonical.com2016-03-282016-04-047
1487729[FFe] Tomahawk 0.8.4 or newer [needs upgrade]tomahawk-playerstef.ahlers@t-online.de2016-03-252016-04-2531
1544160gnome-menus2 replaced by gnome-menusclassicmenu-indicatorginggs@ubuntu.com2016-02-102016-02-155
1559253No app starts when choosen in the menuclassicmenu-indicatorginggs@ubuntu.com2016-03-182016-03-213
1564831s390x: error booting instancelxcfsserge.hallyn@ubuntu.com2016-04-012016-04-043
1565873Double clicking .CAB opens file roller instead of gnome-softwaredesktop-file-utilsmario_limonciello@dell.com2016-04-042016-04-040
1549529The keyboard is still installed as US-English even if another language is selected during the installationconsole-setupcyphermox@ubuntu.com2016-03-242016-04-0411
1565908Allow calendar policy to read from device time zoneapparmor-easyprof-ubuntujamie@ubuntu.com2016-04-042016-04-040
1565010[FFe] Update to php-radius 1.4.0b1php-radiusnish.aravamudan@canonical.com2016-04-012016-04-065
1565097Update to PHP7.0 dependenciesrefdbnish.aravamudan@canonical.com2016-04-012016-04-043
1565960Update to PHP7.0 dependenciesphpsysinfonish.aravamudan@canonical.com2016-04-042016-04-040
1565162Update to PHP7.0 dependenciesscuttlenish.aravamudan@canonical.com2016-04-012016-04-043
1565939Update to PHP7.0 dependenciesphp-dompdfnish.aravamudan@canonical.com2016-04-042016-04-040
1565922Update to PHP7.0 dependencieszabbixnish.aravamudan@canonical.com2016-04-042016-04-073
1565919Update to PHP7.0 dependenciesyubikey-valnish.aravamudan@canonical.com2016-04-042016-04-040
1565918Update to PHP7.0 dependenciesyubikey-ksmnish.aravamudan@canonical.com2016-04-042016-04-040
1565916Update to PHP7.0 dependenciesyatenish.aravamudan@canonical.com2016-04-042016-04-073
1565912Update to PHP7.0 dependencieswikidiff2nish.aravamudan@canonical.com2016-04-042016-04-062
1565907Update to PHP7.0 dependencieswebissues-servernish.aravamudan@canonical.com2016-04-042016-04-040
1565896Update to PHP7.0 dependenciesukolovniknish.aravamudan@canonical.com2016-04-042016-04-040
1565906Update to PHP7.0 dependenciesuwsginish.aravamudan@canonical.com2016-04-042016-04-040
1565894Update to PHP7.0 dependenciestweepernish.aravamudan@canonical.com2016-04-042016-04-040
1565893Update to PHP7.0 dependenciestt-rssnish.aravamudan@canonical.com2016-04-042016-04-040
1565891Update to PHP7.0 dependenciestcpdfnish.aravamudan@canonical.com2016-04-042016-04-040
1565888Update to PHP7.0 dependenciesstacksnish.aravamudan@canonical.com2016-04-042016-04-040
1565879Update to PHP7.0 dependenciessrgnish.aravamudan@canonical.com2016-04-042016-04-040
1565976Update to PHP7.0 dependenciesphp-docnish.aravamudan@canonical.com2016-04-042016-04-040
1566027Should ship an init scripttpm2-tsscyphermox@ubuntu.com2016-04-042016-04-040
1566084Update to PHP7.0 build dependenciesjscribblenish.aravamudan@canonical.com2016-04-052016-04-050
1566085Update to PHP7.0 build dependenciesdatatables.jsnish.aravamudan@canonical.com2016-04-052016-04-050
1566086Update to PHP7.0 build dependenciesjsjacnish.aravamudan@canonical.com2016-04-052016-04-050
1566078Packages refer to incorrect /etc path for PHP 7.0 modulesphp-pecl-httpnish.aravamudan@canonical.com2016-04-052016-04-050
1565585Old debmirrors don't support any of xenial's Translation-* compressionsdebmirrorwgrant@ubuntu.com2016-04-042016-04-051
1563854update-notifier updates-available does not reset after dpkg runupdate-notifieradconrad@ubuntu.com2016-03-302016-04-056
1566073Use /dev/tty0 instead of /dev/console for VT operationslightdmrobert.ancell@canonical.com2016-04-052016-04-050
1561103Multipath assigned user_friendly_names during initramfsmultipath-toolscyphermox@ubuntu.com2016-03-232016-04-0513
1556457[FFe] Demilight (OS/2 weight=350) confuses fontconfigfontconfiggunnarhj@ubuntu.com2016-03-122016-04-0625
1549570pkg-config across multiple sysrootssnapcraftsergio.schvezov@ubuntu.com2016-02-252016-04-0540
1559154Copy plugin should support sourcessnapcraftsergio.schvezov@ubuntu.com2016-03-182016-04-0518
1560553snapcraft error message is not very helpful when using storeapi without being logged insnapcraftsergio.schvezov@ubuntu.com2016-03-222016-04-0514
1561327icon deprecation message doesn't explain the new waysnapcraftsergio.schvezov@ubuntu.com2016-03-242016-04-0512
1561328cleaning a step on a dir built with an old snapcraft doesn't mention that a full clean is needed toosnapcraftsergio.schvezov@ubuntu.com2016-03-242016-04-0512
1561331snapping a dir with old snapcraft files shows: File exists: '/home/elopio/workspace/canonical/snapcraft/ex amples/py2-project/snap/meta/gui'snapcraftsergio.schvezov@ubuntu.com2016-03-242016-04-0512
1561524"Write your own plugins" doc is very out of date.snapcraftsergio.schvezov@ubuntu.com2016-03-242016-04-0512
1562000when running runtest.sh while logged in uploads a snap to the storesnapcraftsergio.schvezov@ubuntu.com2016-03-252016-04-0511
1563535Add 'make_parameters' option to the 'make' plugin.snapcraftsergio.schvezov@ubuntu.com2016-03-292016-04-057
1563760upload an existing snap to the storesnapcraftsergio.schvezov@ubuntu.com2016-03-302016-04-056
1564191kbuild plugin should not run defconf parallelizedsnapcraftsergio.schvezov@ubuntu.com2016-03-312016-04-055
1564607Check for extra keywords used in partssnapcraftsergio.schvezov@ubuntu.com2016-03-312016-04-055
1546260kexec/kdump not working in ubuntu 16.04kexec-toolslouis.bouchard@ubuntu.com2016-02-162016-04-0549
1552368IPv6 address is not displayed in 'Start SSH' invitation during booting the installerdebian-installerxnox@ubuntu.com2016-04-022016-04-053
1316302ubuntu-emulator-runtime uses the same MAC addressgoget-ubuntu-touchmichael.vogt@ubuntu.com2014-05-052016-04-13709
1546776[FFe] charm-tools 2.0python-pathspecmarco@ceppi.net2016-02-172016-04-1255
1563134ICE in gimple_expand_builtin_pow with -O3 on ppc64elgcc-5doko@ubuntu.com2016-03-292016-04-068
1508225tipc tool isn't built in iproute2iproute2pierre-andre.morey@canonical.com2015-10-202016-04-07170
1522371iproute2: seg fault with 'ip link type gre ...' commandsiproute2pierre-andre.morey@canonical.com2015-12-032016-04-07126
1559232lists shutdown/reboot/logout as installed softwaressession-shortcutsiain@orangesquash.org.uk2016-03-182016-04-0518
1564871Builds against libmysqlclient_r, which is now deprecatedcacti-spinerobie.basak@ubuntu.com2016-04-012016-04-076
1566460UTS_UBUNTU_RELEASE_ABI undefined if linux-headers-$ARCHVERSION isn't installedkpatchchris.j.arges@canonical.com2016-04-052016-04-061
1534971banshee freezes on startbansheehyperair@debian.org2016-01-162016-04-0580
1379567maas-proxy is an open proxy with no ACLs; it should add networks automaticallymaasandreserl@ubuntu.com2014-10-092016-04-05544
1565003snmptrapd fails to build with MySQL 5.7net-snmprobie.basak@ubuntu.com2016-04-012016-04-076
1563565swift reporting stopped working, scout.scout() changed result formatlandscape-clientandreas@canonical.com2016-04-052016-04-050
1566387Can not IPL after installation (zipl-installer?)zipl-installerxnox@ubuntu.com2016-04-052016-04-050
1507156please use archive packages instead of embedded code copieslxdstgraber@ubuntu.com2015-10-172016-04-06172
1566253Stopping lxd-containers.service hangslxdstgraber@ubuntu.com2016-04-052016-04-061
1566394PHP bindings are not packagedlibdigidocppnish.aravamudan@canonical.com2016-04-052016-04-050
1566333trusty → xenial upgrade fails to upgrade /etc/init.d/croncronmartin.pitt@ubuntu.com2016-04-052016-04-061
1481832VA-API implementation for gallium missingmesatjaalton@debian.org2015-08-052016-04-07246
1566447PHP bindings only support PHP5libpuzzlenish.aravamudan@canonical.com2016-04-052016-04-050
1566397Update to PHP7.0 build dependencieslibjs-jcropnish.aravamudan@canonical.com2016-04-052016-04-050
1566404PHP bindings only support PHP5lassonish.aravamudan@canonical.com2016-04-052016-04-061
1566429PHP bindings only support PHP5mingnish.aravamudan@canonical.com2016-04-052016-04-061
1566423Update to PHP7.0 build dependencieslibvpxnish.aravamudan@canonical.com2016-04-052016-04-061
1566433PHP bindings only support PHP5libkolabnish.aravamudan@canonical.com2016-04-052016-04-061
1566481phpldapadmin missing dependency php7.0-xmlphpldapadminnish.aravamudan@canonical.com2016-04-052016-04-061
1566587Update to PHP7.0 dependenciessquirrelmailnish.aravamudan@canonical.com2016-04-062016-04-060
1566575Add priority for pecl-http extension so it loads after its dependenciesphp-pecl-httpnish.aravamudan@canonical.com2016-04-052016-04-061
1562060[FFe] Please update to roundcube 1.2roundcubenish.aravamudan@canonical.com2016-03-252016-04-0612
1566572Remove php-zeroc-ice from the build.zeroc-icenish.aravamudan@canonical.com2016-04-052016-04-061
1566375Update to PHP7.0 build dependencieshdf5nish.aravamudan@canonical.com2016-04-052016-04-061
1547297No auto login in Ubuntu GNOME Xenialaccountsservicetim@feathertop.org2016-04-062016-04-060
1546317Accessibility indicator is missing from ubiquity-dm at the "Try Ubuntu" dialogubiquitythemuso@ubuntu.com2016-03-172016-04-0620
1555167s390-tools: missing utilities in s390-tools package (cpuplugd, vmconvert, etc.)s390-toolsxnox@ubuntu.com2016-03-092016-04-0729
1564496s390: missing cpuplugds390-toolsxnox@ubuntu.com2016-03-312016-04-077
1564690s390 missing dumpconf services390-toolsxnox@ubuntu.com2016-04-012016-04-1413
1564696s390-tools: missing qethqoat, vmconvert, zfcpdbfs390-toolsxnox@ubuntu.com2016-04-012016-04-076
1564699s390-tools: missing osasnmpds390-toolsxnox@ubuntu.com2016-04-012016-04-076
1557461ceph-osd-prestart.sh is called with wrong optionscephjames.page@ubuntu.com2016-03-152016-04-0622
1564917Default task limit from systemd is too low for cephcephjames.page@ubuntu.com2016-04-012016-04-065
1565709FFe: Please updated ubuntu-mate-meta to add ubuntu-snappy-cliubuntu-mate-metaadconrad@ubuntu.com2016-04-042016-04-062
1515810Doesn't merge into unity panel when maximizedubuntu-mate-artworkcode@flexion.org2015-11-132016-03-10118
1545026Video Progress Too Subtle on Apple Movie Trailersubuntu-mate-artworkcode@flexion.org2016-02-122016-03-2542
1563971ubuntu-mate-artwork 16.04.6 bug fix release [debdiff attached]ubuntu-mate-artworkcode@flexion.org2016-03-302016-04-067
1565043Please enable HTTP/2 in NGINX for Xenialnginxteward@ubuntu.com2016-04-012016-04-065
1566392[FFe] Update nginx to 1.9.14nginxteward@ubuntu.com2016-04-052016-04-061
1566798Fails to build with mysql-5.7ruby-mysql2robie.basak@ubuntu.com2016-04-062016-04-071
1523508Building xorg-gtest fails with new pkg-configpkg-configdoko@ubuntu.com2015-12-072016-04-07122
1446851systemd[1]: Cannot add dependency job for unit gssproxy.servicenfs-utilsbryan.quigley@canonical.com2015-04-212016-04-06351
1452667rpc-svcgssd.service makes the system boot degradednfs-utilsbryan.quigley@canonical.com2015-05-072016-04-06335
1566651Blurry fonts after update to fontconfig 2.11.1-0ubuntu9fontconfiggunnarhj@ubuntu.com2016-04-062016-04-060
1566981Add build-dep on libcurl-devphp-pecl-httpnish.aravamudan@canonical.com2016-04-062016-04-060
1567002Update to PHP7.0 dependencies.squirrelmail-decodenish.aravamudan@canonical.com2016-04-062016-04-060
1566296Please upgrade python-keystoneauth1 for xenialpython-keystoneauth1corey.bryant@canonical.com2016-04-052016-04-083
1514407NoCloud provider fails with empty ds_cfgcloud-initsmoser@ubuntu.com2016-04-062016-04-060
1536964Remove obsolete syslog.target dep from systemd servicescloud-initsmoser@ubuntu.com2016-04-062016-04-060
1548772mkfs fails on interactive input when no partition is usedcloud-initsmoser@ubuntu.com2016-04-042016-04-062
1553345Chef gem installer fails on ubuntu 14.04cloud-initsmoser@ubuntu.com2016-04-042016-04-062
1558069Login complains "Your environment specifies an invalid locale", doesn't say which localecloud-initsmoser@ubuntu.com2016-03-162016-04-0621
1562918cloud-init does not create defined userscloud-initsmoser@ubuntu.com2016-03-282016-04-069
1565638Cloud-init on Xenial won't deploy compressed content in "write_files" - says DecompressionError: Not a gzipped filecloud-initsmoser@ubuntu.com2016-04-042016-04-062
1566764LXD network setup question could be more explicitlxdstgraber@ubuntu.com2016-04-062016-04-071
1406825xscreensaver complains "This version of xscreensaver is VERY OLD!"xscreensaverunit193@ubuntu.com2014-12-312016-04-07463
1566917dep8 test failuresruby-mysqlrobie.basak@ubuntu.com2016-04-062016-04-071
1566924kpatch should output the kernel build in debug modekpatchchris.j.arges@canonical.com2016-04-062016-04-071
1566878Alt-backtick regressionxorg-servertjaalton@debian.org2016-04-062016-04-071
1535219HP ZBook 15u mic mute button doesn't worksystemdmartin.pitt@ubuntu.com2016-01-182016-04-0881
1564976systemd-udevd crashed with SIGSEGV with rules file appending large number of tagssystemdmartin.pitt@ubuntu.com2016-04-012016-04-087
1565617"polkitd.service is masked" warnings on package install while policykit-1 is unpacked but not yet configuredsystemdmartin.pitt@ubuntu.com2016-04-042016-04-084
1397880[Feature] Memory Bandwidth Monitoringlinuxtim.gardner@canonical.com2016-04-062016-04-082
1461365[Feature]intel_idle driver support for Knights Landinglinuxtim.gardner@canonical.com2016-03-302016-04-089
1519623[Feature]USB core and xHCI tasks for USB 3.1 SuperSpeedPlus (SSP) support for Alpine Ridge on SKLlinuxtim.gardner@canonical.com2016-04-062016-04-082
1546439ISST:LTE: Regression: roselp2 Oops in kernel during setup iolinuxtim.gardner@canonical.com2016-02-172016-04-0851
1547231/proc/$pid/maps performance regressionlinuxtim.gardner@canonical.com2016-02-182016-04-0850
1556096[Ubuntu 16.04.1] RELEASE and ACQUIRE atomics on Powerlinuxtim.gardner@canonical.com2016-03-112016-04-0828
1556228HP Notebook Probook 440 G3 HDA Intel PCH horrible sounds while bootinglinuxtim.gardner@canonical.com2016-03-112016-04-0828
1558275wrong/missing permissions for device file /dev/prandom (prng.ko)linuxtim.gardner@canonical.com2016-03-162016-04-0823
1559923[Bug]Lenovo Yoga 260 and Carbon X1 4th gen freeze on HWP enablelinuxtim.gardner@canonical.com2016-04-042016-04-084
1563485cxlflash: Backport upstream cxlflash commits and submitting a noup patch to Xeniallinuxtim.gardner@canonical.com2016-03-292016-04-0810
1563688[Hyper-V] patch inclusion in 16.04 for NIC hot add/removelinuxtim.gardner@canonical.com2016-03-302016-04-089
1563921Unable to migrate containerlinuxtim.gardner@canonical.com2016-03-302016-03-300
1564206fix for do_tools_cpupower when cross-compilinglinuxtim.gardner@canonical.com2016-03-312016-04-088
1564591Sync kernel zfs 0.6.5.6 - align with zfsutils-linux and spl packageslinuxtim.gardner@canonical.com2016-03-312016-04-088
1564712The Front MIC jack can't work on a HP desktop machinelinuxtim.gardner@canonical.com2016-04-012016-04-087
1564759[i915_bpo] Fix RC6 on SKL GT3 & GT4linuxtim.gardner@canonical.com2016-04-012016-04-087
1565765please provide mmc-modules udeblinuxtim.gardner@canonical.com2016-04-042016-04-084
1565967[Hyper-V] Additional PCI passthrough commitslinuxtim.gardner@canonical.com2016-04-042016-04-084
1566221linux: Enforce signed module loading when UEFI secure bootlinuxtim.gardner@canonical.com2016-04-052016-04-1914
1566283CONFIG_ARCH_ROCKCHIP not enabled in armhf generic kernellinuxtim.gardner@canonical.com2016-04-052016-04-083
1566505User namespace mount updateslinuxtim.gardner@canonical.com2016-04-052016-04-083
1566518[arm64] kernel BUG at /build/linux-StrpB2/linux-4.4.0/fs/ext4/inode.c:2394!linuxtim.gardner@canonical.com2016-04-052016-04-083
1566868linux: 4.4.0-18.34 -proposed trackerlinuxtim.gardner@canonical.com2016-04-062016-04-082
1566406postinst fails on mysql_upgrade if database is already upgradedmysql-5.7robie.basak@ubuntu.com2016-04-052016-04-072
1566858Add support for MySQL 5.7ruby-dataobjects-mysqllars.tangvald@oracle.com2016-04-062016-04-071
1567322Sync dune-common 2.4.1-1 and related packages (universe) from Debian unstable (main)dune-grid-glueadconrad@ubuntu.com2016-04-072016-04-070
1566141sleep inhibitor uses deprecated interfaceupdate-managerbrian@ubuntu.com2016-04-052016-04-072
1556916openstack-on-lxd: dashboard theme is b0rkedhorizonjames.page@ubuntu.com2016-03-142016-04-0724
1565865Ubuntu patches make applying firmware updates not possiblecaspermario_limonciello@dell.com2016-04-072016-04-070
1546116manila share process init script is missingmaniladdv@canonical.com2016-02-162016-04-0751
1567381qemu threads should not be counted in libvirt.service tasks limitlibvirtserge.hallyn@ubuntu.com2016-04-072016-04-070
1377873deja-dup fails to restore missing files, that contain "german umlaut" (ä,ö,ü,Ä,Ö,Ü).deja-dupmterry@ubuntu.com2014-10-062016-04-07549
1567440debconf for bridge configuration is confusing and too complicatedlxdstgraber@ubuntu.com2016-04-072016-04-070
1561954Ubuntu Server install menu needs a 16.04 refreshmaasandreserl@ubuntu.com2016-03-252016-04-0814
1567158Please merge php7.0 7.0.4-7 from Debian unstablephp7.0nish.aravamudan@canonical.com2016-04-072016-04-081
1509655release upgrade crashed on custom configuration file dialogubuntu-release-upgraderbrian@ubuntu.com2015-10-242016-04-08167
1555446byobu-select-session should exec on last linebyobukirkland@ubuntu.com2016-03-102016-04-0829
1564320Tries to fetch EC2 metadata outside EC2 on xenialbyobukirkland@ubuntu.com2016-03-312016-04-088
1563182Erlang builds missing erlang-wx componenterlangsteve.langasek@ubuntu.com2016-03-292016-04-0810
1565978ISST-LTE:pVM: golang does not support huge amount (>256) CPUs machines (as E870)golang-1.6michael.hudson@ubuntu.com2016-04-042016-04-084
1566928gnupg-agent: no longer writes $GNUPGHOME/gpg-agent-info-$(hostname) filegnupg2xnox@ubuntu.com2016-04-062016-04-082
1567899alembic migration failure with mysql 5.7neutron-vpnaasjames.page@ubuntu.com2016-04-082016-04-080
1566552gccgo duplicate symbols linking testsgccgo-6doko@ubuntu.com2016-04-052016-04-116
1532198[MIR] zfs-linuxzfs-linuxcolin.king@canonical.com2016-01-082016-04-0891
1557515kernel and os snaps need to use "snapcraft snap" instead of "snappy build"livecd-rootfsogra@ubuntu.com2016-03-152016-04-0824
1552914Can't install libboost-dev:armhf in a cross-build environmentboost-defaultsxnox@ubuntu.com2016-03-032016-04-0836
1568026Fix include_path during autopkgtestsphp-sabredavnish.aravamudan@canonical.com2016-04-082016-04-080
1568015Fix compatibility with mysql 5.7php-horde-dbnish.aravamudan@canonical.com2016-04-082016-04-080
1564832Apparmor profile for NTPd needs to allow read/write access to /dev/ppsXntpjamie@ubuntu.com2016-04-012016-04-087
1568095FFE for nova-lxd 13.0.0nova-lxdzulcss@ubuntu.com2016-04-082016-04-080
1567874IPv4/6 setup debconf questions default to "no"lxdstgraber@ubuntu.com2016-04-082016-04-080
1568155acpid shouldn't run in a containeracpidsimon.deziel@gmail.com2016-04-082016-04-091
1568136cacti depends on xml and mbstring extensions at runtimecactinish.aravamudan@canonical.com2016-04-082016-04-091
1550912python-lxc segfaults when calling get_ips()python-lxcstgraber@ubuntu.com2016-02-282016-04-0941
1210514Default apache prefork profile doesn't allow chownapparmortyhicks@canonical.com2013-08-092016-04-11976
1272028remount, not honored on bind mountsapparmortyhicks@canonical.com2014-01-232016-04-11809
1393979py tests depend on /etc/apparmor/logprof.confapparmortyhicks@canonical.com2014-11-182016-04-20519
1501913Apparmor Abstraction Prevents Firefox From Opening Torrents in Deluge-Gtkapparmortyhicks@canonical.com2015-10-012016-04-11193
1505775aa-autodep fails if shebang line contains parametersapparmortyhicks@canonical.com2015-10-132016-04-20190
1525119Cannot permit some operations for sssdapparmortyhicks@canonical.com2015-12-112016-04-11122
1528139serialize_profile_from_old_profile() crash if file contains multiple profilesapparmortyhicks@canonical.com2015-12-212016-04-11112
1534405Regression in parser compiling/loading a directoryapparmortyhicks@canonical.com2016-01-152016-04-1187
1540562aa-genprof crashes in logparser NoneType has no "replace"apparmortyhicks@canonical.com2016-02-012016-04-1170
1561762[FFe] AppArmor 2.11 Beta 1 for policy namespace stacking and bug fixesapparmortyhicks@canonical.com2016-03-242016-04-1118
1508770oneliner-el: FTBFS: manuals build fails against textinfo5 because some incompatibles changes wrt 4.13 and below (some warnings have turned into errors)oneliner-ellogan@ubuntu.com2015-10-222016-04-09170
1562229apticron fails when mailx is provided by s-nailapticronadconrad@ubuntu.com2016-03-262016-04-1015
1567658ubuntuBSD supportbrlttythemuso@ubuntu.com2016-04-072016-04-114
1568137package brltty 5.3.1-2ubuntu1 failed to install/upgrade: subprocess installed post-installation script returned error exit status 1brlttythemuso@ubuntu.com2016-04-082016-04-113
1568534package unity-accessibility-profiles (not installed) failed to install/upgrade: trying to overwrite '/usr/share/a11y-profile-manager/profiles/motor-difficulties/profile.manifest', which is also in package liba11y-profile-manager-data 0.1.8-0ubuntu1a11y-profile-managerthemuso@ubuntu.com2016-04-102016-04-111
1567993alsa-utils does not store and restore alsa settings on boot rebootalsa-utilsthemuso@ubuntu.com2016-04-082016-04-157
1562515'Preferences' button in Public directory doesn't respondgnome-user-sharetim@feathertop.org2016-03-282016-04-1114
1551446xenial boots to black wallpaper.lubuntu-default-settingsgilir@ubuntu.com2016-03-072016-04-1135
1562049[FFe] Please sync unity-tweak-tool 0.0.7 from upstream gitunity-tweak-toolfreyja-dev@lists.launchpad.net2016-03-252016-04-1117
1527426Merge pepperflashplugin-nonfree (1.8.2) from Debian unstable (contrib)pepperflashplugin-nonfreemty.shibata@gmail.com2015-12-182016-04-11115
1555139needs a mstflint4 transitional package to allow for smooth upgrade from mstflint4mstflintlouis.bouchard@ubuntu.com2016-03-092016-04-1133
1567811nova-compute should depend on libvirt-bin.service instead of libvirtd.service novajames.page@ubuntu.com2016-04-082016-04-113
1568793[FFe] mysql-connector-c++ and mysql-workbench bump for 5.7mysql-workbenchlars.tangvald@oracle.com2016-04-112016-04-121
1568912NM autopkgtests fail IPv6 validation for non-SLAAC casesnetwork-managercyphermox@ubuntu.com2016-04-112016-04-110
1454273irqbalance should not run in containerirqbalancesimon.deziel@gmail.com2015-05-122016-04-11335
1556308[FFe] Please merge unbound 1.58-1 from Debian unstableunboundnish.aravamudan@canonical.com2016-03-112016-04-1131
1568954lvmetad should not run in containerlvm2simon.deziel@gmail.com2016-04-112016-04-110
1568993mdadm should not run in containermdadmsimon.deziel@gmail.com2016-04-112016-04-110
1567688[FFe] netcfg should ask if dhcp should be used on s390xnetcfgxnox@ubuntu.com2016-04-072016-04-114
1560149missing seccomp whitelist for qemu-kvmqemuserge.hallyn@ubuntu.com2016-03-222016-04-1221
1548489[FFe] Let's get LXD 2.0 final in Xeniallxdstgraber@ubuntu.com2016-02-222016-04-1149
1569071/usr/bin/bat in alsa-utils conflicts with /usr/bin/bat in bacula-qt-consolealsa-utilsthemuso@ubuntu.com2016-04-112016-04-121
1569057tpm2-tools should depend on libtss2-utilstpm2-toolscyphermox@ubuntu.com2016-04-112016-04-121
1528710overly agressive URLField validation causes failurespython-djangolamont@canonical.com2015-12-222016-04-12112
1569077Incorrect regex for TLDs causes locally defined TLDs to be rejectedpython-formencodelamont@canonical.com2016-04-112016-04-121
1561215Upgrade to 16.04 blocked by firewall due to HTTP violationupdate-managerbrian@ubuntu.com2016-03-232016-04-1220
1398143Ltrace is broken on ppc64elltracecyphermox@ubuntu.com2014-12-012016-04-12498
1547152ltrace is throwing segfault while running any of the userspace commandltracecyphermox@ubuntu.com2016-02-182016-04-1254
1561096STC850:Brazos:Br16:Br16p05: Network ethernet port name changed under Ubuntu 16.04 with added adapters (ibmveth)systemdmartin.pitt@ubuntu.com2016-03-232016-04-1220
15635901.25.4, xenial, init script install error racesystemdmartin.pitt@ubuntu.com2016-04-112016-04-121
1565969Udev rule causes automatic incorrect unmount of dm devicesystemdmartin.pitt@ubuntu.com2016-04-042016-04-128
1569204xenial regression: does not start any more under upstartnetwork-managermartin.pitt@ubuntu.com2016-04-122016-04-120
1561302gdm won't allow passwordless logingdm3tim@feathertop.org2016-03-242016-04-1219
1488962systemd does not notice when services created via systemd-sysv-generator failapache2pierre-andre.morey@canonical.com2015-08-262016-04-12230
1557830[needs-packaging] juju-mongodb2.6 in xenial, wily, and trustyjuju-mongodb2.6robie.basak@ubuntu.com2016-03-162016-04-1429
1558270[Ubuntu 16.04] update-notifier motd doesn't update with apt full-upgradeupdate-notifierxnox@ubuntu.com2016-03-162016-04-1227
1568784Fails to build with MySQL 5.7libdbi-driverslars.tangvald@oracle.com2016-04-112016-04-121
1515731owncloud client completely outdatedowncloud-clienttjaalton@debian.org2015-11-122016-04-12152
1569359zfs-linux: libs should not be installed in /libzfs-linuxcolin.king@canonical.com2016-04-122016-04-120
1569391s390x: popcnt (B9E1) support incompletevalgrinddannf@ubuntu.com2016-04-122016-04-120
1569538Mount points fail removalnova-lxdzulcss@ubuntu.com2016-04-122016-04-120
1569232Please update non-languagepack translations for 16.04 LTS releaseubiquitycyphermox@ubuntu.com2016-04-122016-04-131
1566944dnsmasq profile prevents LXD container to launchapparmortyhicks@canonical.com2016-04-062016-04-137
1569316Log flooded with run/dbus/system_bus_socket wr deniedapparmortyhicks@canonical.com2016-04-122016-04-131
1569573recent snapd path renames causes apparmor to not load profiles on bootapparmortyhicks@canonical.com2016-04-122016-04-131
1553309[FFe]: Include FIPS 140-2 into openssl packageopenssljoy.latten@canonical.com2016-03-042016-04-1340
1569630charm-tools 2.1.2 is not installablecharm-toolsjames.page@ubuntu.com2016-04-132016-04-130
1569770systemd not correctly detectedceph-deployjames.page@ubuntu.com2016-04-132016-04-130
1560545[FFe] hwup/down is racy, migrate to chzdev (previously: Some or all OSA devices may be unavailable after boot if too many are visible)s390-sysconfig-writerxnox@ubuntu.com2016-04-082016-04-135
1507921When hugepages is set vm.max_map_count is not automatically adjusteddpdkchristian.ehrhardt@canonical.com2016-03-152016-04-1329
1566874Adding up to MAX_VHOST vhost_user sockets breaks openvswitch-dpdkdpdkchristian.ehrhardt@canonical.com2016-04-062016-04-137
1568838Recommended Backports from DPDK 16.04 for DPDK 2.2 - round 2dpdkchristian.ehrhardt@canonical.com2016-04-112016-04-132
1569375lpm_autotest crashing with dpdk 2.2dpdkchristian.ehrhardt@canonical.com2016-04-122016-04-131
1550301ZFS: Set elevator=noop on disks in the root poolzfs-linuxcolin.king@canonical.com2016-02-262016-04-1347
1551285ubiquity crashed with UnicodeDecodeError in decode(): 'ascii' codec can't decode byte 0xc5 in position 8782: ordinal not in range(128)localechoosercyphermox@ubuntu.com2016-04-132016-04-130
1569454Provide daemon support via systemd for mon_fsstatd, mon_procd, mon_statds390-toolsxnox@ubuntu.com2016-04-122016-04-131
1568485kernel: audit: type=1400 audit(1460259033.648:34): apparmor="DENIED" operation="sendmsg" info="Failed name lookup - disconnected path" error=-13isc-dhcptyhicks@canonical.com2016-04-102016-04-133
654065ssmtp.conf securityssmtpsimon.deziel@gmail.com2010-10-032016-04-142020
1553353tail'ing a file in a script session hangsutil-linuxsimon.deziel@gmail.com2016-03-042016-04-1340
1569698starting lxd fails in a loop on slow machineslxdstgraber@ubuntu.com2016-04-132016-04-130
1566824phone_home module should allow fqdn to be postedcloud-initsmoser@ubuntu.com2016-04-132016-04-130
1568150xenial lxc containers not startingcloud-initsmoser@ubuntu.com2016-04-132016-04-130
1569018[FFe] support lxc bridge configurationcloud-initsmoser@ubuntu.com2016-04-112016-04-132
1569469smartos datasource stacktrace if no system-product-name in dmi datacloud-initsmoser@ubuntu.com2016-04-122016-04-131
1569974networking fallback should ignore bridgescloud-initsmoser@ubuntu.com2016-04-132016-04-130
1569226click-review crashed with KeyError in check_apps_plugs_mapped_oldsecurity(): 'plugs'click-reviewers-toolsjamie@ubuntu.com2016-04-122016-04-131
1569289glance should support the root-tar disk formatglancezulcss@ubuntu.com2016-04-122016-04-131
1570038libopencryptoki-dev Package: -lopencryptoki option does not find provided /usr/lib/opencryptoki/libopencryptoki.so Library fileopencryptokixnox@ubuntu.com2016-04-132016-04-130
1567107[Hyper-V] hyperv_keyboard module needed for Generation 2 VMsinitramfs-toolsapw@ubuntu.com2016-04-062016-04-148
1560940None matching mokutils passwordsubiquitycyphermox@ubuntu.com2016-03-232016-04-1321
1567445ubi-prepare failed with exit code 255ubiquitycyphermox@ubuntu.com2016-04-072016-04-136
1569626[FFe] Sync urdfdom 0.4.1-1 (universe) from Debian unstable (main)ros-robot-modelmartin.pitt@ubuntu.com2016-04-132016-04-130
1545764Playing a CD in Rhythmbox with cross fading on crashes rbrhythmboxseb128@ubuntu.com2016-02-152016-04-1358
1570055FTBFS on powerpclua5.3steve.langasek@ubuntu.com2016-04-132016-04-141
1566975AssertionError on .proc.driver.nvidia.gpus.0000:01:00.0apportmartin.pitt@ubuntu.com2016-04-062016-04-148
1567098Cannot log in as root user when not root Unix usermysql-5.7robie.basak@ubuntu.com2016-04-062016-04-148
1567695mysql-server-5.7.postinst is influenced by $HOME, causing installation hangsmysql-5.7robie.basak@ubuntu.com2016-04-072016-04-147
1530518/etc/cron.weekly/apt-xapian-index reports TypeErrorapt-xapian-indexbarry@ubuntu.com2016-01-022016-04-14103
1322724Ubuntu One in firefox bookmarksfirefoxchris.coulson@canonical.com2014-05-232016-04-14692
1537742"Contribute to Xubuntu" and "Xubuntu Website" menu items on the desktop right-click menuxubuntu-default-settingssmd.seandavis@gmail.com2016-01-252016-04-1480
1560797apt does not configure Pre-Depends: before depending packageaptmartin.pitt@ubuntu.com2016-04-082016-04-146
1568336pppd crashed with SIGSEGV in plugin_init()network-manager-pptpcyphermox@ubuntu.com2016-04-092016-04-145
1569509Backport 186844b from php-srcphp7.0nish.aravamudan@canonical.com2016-04-122016-04-142
1477904snapcraft.yaml needs to make all stages dirty (was: the can't add file without recreating entire package)snapcraftsergio.schvezov@ubuntu.com2015-07-242016-04-14265
1536691Missing option to disable geoip for fetching stage-/build-packagessnapcraftsergio.schvezov@ubuntu.com2016-01-212016-04-1484
1537790lifecycle: rebuild with snapcraft clean part1; snapcraft build part1 breaks if part1 has an 'after' fieldsnapcraftsergio.schvezov@ubuntu.com2016-01-252016-04-1480
1548232Snapcraft messes with include path precedence in unhealthy wayssnapcraftsergio.schvezov@ubuntu.com2016-02-222016-04-1452
1551849Get rid of global statesnapcraftsergio.schvezov@ubuntu.com2016-03-012016-04-1444
1561068cannot use ppa or deb source packages convenientlysnapcraftsergio.schvezov@ubuntu.com2016-03-232016-04-1422
1564181missing test for the mosquitto examplesnapcraftsergio.schvezov@ubuntu.com2016-03-312016-04-1414
1566153Snapcraft should detect .git extension as source_type='git'snapcraftsergio.schvezov@ubuntu.com2016-04-052016-04-149
1566882vcs tools integration tests should declare their dependenciessnapcraftsergio.schvezov@ubuntu.com2016-04-062016-04-148
1567041snapcraft init creates icon entrysnapcraftsergio.schvezov@ubuntu.com2016-04-062016-04-148
1567058commands are messy with module loadingsnapcraftsergio.schvezov@ubuntu.com2016-04-062016-04-148
1568004Clean: Don't automatically clean reverse dependencies.snapcraftsergio.schvezov@ubuntu.com2016-04-082016-04-146
1568826Remove configuration incantationssnapcraftsergio.schvezov@ubuntu.com2016-04-112016-04-143
1569280Snapcraft fails to strip go binaries on armsnapcraftsergio.schvezov@ubuntu.com2016-04-122016-04-142
1569401example tests are failing because they call the old snappy commandsnapcraftsergio.schvezov@ubuntu.com2016-04-122016-04-142
1569452Update snapcraft to use new interfacessnapcraftsergio.schvezov@ubuntu.com2016-04-122016-04-142
1568771FTBFS on Xeniallibgda5robie.basak@ubuntu.com2016-04-112016-04-143
1570282FFE: add middle button software arealibinputtjaalton@debian.org2016-04-142016-04-151
1569249Quiesce ceph-common postinstcephjames.page@ubuntu.com2016-04-122016-04-153
1554164Invalid read in get_changelog()gnome-softwareiain.lane@canonical.com2016-03-072016-04-1438
1568021Applications from universe are marked as non-freegnome-softwareiain.lane@canonical.com2016-04-082016-04-146
1569328Almost all free software has "nonfree" taggnome-softwareiain.lane@canonical.com2016-04-122016-04-142
1504288Test suite failure with Python 3.4 & 3.5python-configgluemartin.pitt@ubuntu.com2015-10-082016-04-14189
1319835FFE: please enable openclmesatjaalton@debian.org2014-05-152016-04-15701
1563487do not delete /etc/network/interfaces.d/eth0.cfglivecd-rootfsdaniel.watkins@canonical.com2016-04-152016-04-150
1570251Merge final release gvfs 1.28.0-1 (main) from Debian testing (main)gvfsiain.lane@canonical.com2016-04-142016-04-151
1567473s390-tools: missing ts-shells390-toolsxnox@ubuntu.com2016-04-072016-04-147
1546457libc6 2.15-0ubuntu10.13 doesn't mark reboot-requiredglibcadconrad@ubuntu.com2016-02-172016-04-1558
1560577Confusing new locale-gen behaviorglibcadconrad@ubuntu.com2016-03-222016-04-1524
1564918glibc/s390: Save and restore fprs/vrs while resolving symbols.glibcadconrad@ubuntu.com2016-04-012016-04-1514
1569064ifupdown wants to configure interfaces it shouldn't (lxdbr0 or veth)cloud-initsmoser@ubuntu.com2016-04-112016-04-143
1522418[Ubuntu 16.04] libservicelog package updatelibservicelogsteve.langasek@ubuntu.com2015-12-032016-04-14133
1522419[Ubuntu 16.04] servicelog package updateservicelogsteve.langasek@ubuntu.com2015-12-032016-04-14133
1521679[Ubuntu 16.04] libvpd package updatelibvpdsteve.langasek@ubuntu.com2015-12-012016-04-15136
1451728[master] kde-config-telepathy-accounts package install errorkaccounts-integrationsgclark@kubuntu.org2016-03-122016-04-1534
1570578support @complain directiveubuntu-core-launcherjamie@ubuntu.com2016-04-142016-04-151
1570581revert removal of /usr bind mount in 1.0.23ubuntu-core-launcherjamie@ubuntu.com2016-04-142016-04-151
1570479[UIFe][FFe] Change application Name etc to Ubuntu Softwareubiquity-slideshow-ubuntucyphermox@ubuntu.com2016-04-142016-04-195
1564401launcher does not apply cgroups on 16.04ubuntu-core-launcherjamie@ubuntu.com2016-03-312016-04-1515
1535098Uninformative link in Release Notes windowubuntu-release-upgraderbrian@ubuntu.com2016-01-172016-04-1589
1565177screensaver is not disabled during release upgradeubuntu-release-upgraderbrian@ubuntu.com2016-04-022016-04-1513
1538882virt-aa-helper restricts arm64 QEMU_EFI.fd binary libvirtwgrant@ubuntu.com2016-01-282016-04-1578
1570712does not run any snapubuntu-core-launchermichael.vogt@ubuntu.com2016-04-152016-04-150
1570652ubuntu-mate-welcome 16.04.8 bug fix and translations [dsc attached]ubuntu-mate-welcomecode@flexion.org2016-04-152016-04-150
1569320ubuntu-mate-settings 16.04.5 release [.dsc included]ubuntu-mate-settingscode@flexion.org2016-04-122016-04-153
1570380Build with mysqlclient instead of mysqlclient_rtarantool-ltslars.tangvald@oracle.com2016-04-142016-04-151
1558198[FFE] sync open-vm-tools from Debian for Xenialopen-vm-toolssteve.langasek@ubuntu.com2016-03-162016-04-1530
1570812[UIFe] Window actions such as Minimize, Maximize, Restore, Move, Resize... Aren't accessible from HUDlibwnck3laney@debian.org2016-04-152016-04-150
1442586gfxboot-theme-ubuntu needs an update with new translations exportgfxboot-theme-ubuntucjwatson@ubuntu.com2015-04-102016-04-15371
1570914inconsistent apps/key validationclick-reviewers-toolsjamie@ubuntu.com2016-04-152016-04-150
1536245s390x kernel image needs weightwatcherslinuxtim.gardner@canonical.com2016-01-202016-04-1990
1554003xenial kernel crash on HP BL460c G7 (qla24xx problem?)linuxtim.gardner@canonical.com2016-03-072016-04-1943
1554260CVE-2016-2847linuxtim.gardner@canonical.com2016-03-072016-04-1943
1555344s390/cpumf: Fix lpp detectionlinuxtim.gardner@canonical.com2016-03-092016-04-1941
1564901xpad rumble causes full system hanglinuxtim.gardner@canonical.com2016-04-012016-04-1918
1566468systemd-modules-load.service: Failing due to missing module 'ib_iser'linuxtim.gardner@canonical.com2016-04-072016-04-1912
1567091fixes for thunderx nic in multiqueue modelinuxtim.gardner@canonical.com2016-04-062016-04-1913
1567093thunderx nic performance improvementslinuxtim.gardner@canonical.com2016-04-062016-04-1913
1567581Surelock GA2 SP1: surelock02p05: Not seeing sgX devices for LUNs after upgrading to Ubuntu 16.04linuxtim.gardner@canonical.com2016-04-072016-04-1912
1570348linux: 4.4.0-19.35 -proposed trackerlinuxtim.gardner@canonical.com2016-04-142016-04-195
1559933[Grub] There are messy codes on displaying Chinese characters in grub after install xenial-desktop_0320.freetypecyphermox@ubuntu.com2016-04-142016-04-151
1570987backuppc: Lib.pm: Unescaped left brace in regex is deprecatedbackuppcsimon.deziel@gmail.com2016-04-152016-04-150
1568637network config of initramfs devices writes 'auto', breaking iscsi root bootcloud-initsmoser@ubuntu.com2016-04-112016-04-154
1569649NetworkManager-wait-online.service not enabled after network-manager installation network-managercyphermox@ubuntu.com2016-04-132016-04-152
1571048ubuntu-core-launcher querying udev for wrong nameubuntu-core-launcherjamie@ubuntu.com2016-04-152016-04-150
1570947Trusty to Xenial upgrade KeyError: 'SUDO_UID'ubuntu-release-upgraderbrian@ubuntu.com2016-04-152016-04-161
1556451xenial lvm2-monitor.service fails with lvm raid1 volumeslvm2steve.langasek@ubuntu.com2016-03-122016-04-1635
1561228dmevent can not open shared object file libdevmapper-event-lvm2snapshot.so leads to lvcreate/lvremove being slowlvm2steve.langasek@ubuntu.com2016-03-232016-04-1624
1566465[regression]: Failed to call clock_adjtime(): Invalid argumentlinuxtim.gardner@canonical.com2016-04-052016-04-1914
1570441Kernel Panic in Ubuntu 16.04 netboot installerlinuxtim.gardner@canonical.com2016-04-142016-04-195
1570906sysfs mount failure during stateful lxd snapshotslinuxtim.gardner@canonical.com2016-04-152016-04-194
1571069linux: 4.4.0-20.36 -proposed trackerlinuxtim.gardner@canonical.com2016-04-152016-04-194
1569337snapcraft kernel plugin needs to check compression method of the initrd before trying to unpack itsnapcraftkyle@canonical.com2016-04-122016-04-164
1569734snapcraft kernel: Failed to download 'ubuntu-core/edge'snapcraftkyle@canonical.com2016-04-132016-04-163
1570414Snapcraft doesn't check if cross-compiling before trying to install necessary toolssnapcraftkyle@canonical.com2016-04-142016-04-162
1570706Snapcraft cleanbuild command doesn't worksnapcraftkyle@canonical.com2016-04-152016-04-161
1570835snapcraft 2.8 fails on s390xsnapcraftkyle@canonical.com2016-04-152016-04-161
1570945Add SNAP_LIBRARY_PATH to LD_LIBRARY_PATHsnapcraftkyle@canonical.com2016-04-152016-04-161
1562406[FFe] Update to latest upstream versionlibqaptscott@kitterman.com2016-03-262016-04-1722
1569968LibreOffice in Xubuntu should use Elementary as installation default not just live sessionxubuntu-default-settingssmd.seandavis@gmail.com2016-04-172016-04-170
1571198Missing symlink in python2.7-dbg packagepython2.7doko@ubuntu.com2016-04-162016-04-182
1571317Wireless lock icon shows white against white xubuntu-artworksmd.seandavis@gmail.com2016-04-172016-04-170
1571491possible auth bypasssnapdmichael.vogt@ubuntu.com2016-04-182016-04-180
1557675AppStream icon for xpdf.desktopxpdfiain@orangesquash.org.uk2016-03-152016-04-1834
1570901Cd menu not booting to ubiquity try/install menu but always to live sessionubiquitymartin.pitt@ubuntu.com2016-04-152016-04-183
1565889/install/filesystem.squashfs should be signedlive-installerxnox@ubuntu.com2016-04-042016-04-1814
1571278accessing the web interface gives an error 500backuppcsimon.deziel@gmail.com2016-04-172016-04-181
1558409AppStream icon for display-im6.desktopimagemagickiain@orangesquash.org.uk2016-03-172016-04-1832
1558412AppStream icon for banshee.desktopbansheeiain@orangesquash.org.uk2016-03-172016-04-1832
1551343Remove qml pluginsnapcraftsergio.schvezov@ubuntu.com2016-02-292016-04-2051
1571264internal api needs to be explicitsnapcraftsergio.schvezov@ubuntu.com2016-04-162016-04-204
1571446catkin plugin fails to worksnapcraftsergio.schvezov@ubuntu.com2016-04-182016-04-202
1567301Untranslated buttonsonboardfrancesco.fumanti@gmx.net2016-04-072016-04-1811
1571684libisoburn fails to build on powerpclibisoburndoko@ubuntu.com2016-04-182016-04-180
1571699Configdrive failurenova-lxdzulcss@ubuntu.com2016-04-182016-04-180
1571635ubuntu-mate-welcome 16.04.9 bug fix update [dsc attached]ubuntu-mate-welcomelogan@ubuntu.com2016-04-182016-04-180
1449304ipa-replica-prepare failsfreeipatjaalton@debian.org2015-04-272016-04-19358
1564981freeipa install errors out with certmonger 'dbus' 'start' ''' returned non-zero exit status 4freeipatjaalton@debian.org2016-04-012016-04-1918
1571432Cacti package is incompatible with PHP7 on Xenialcactinish.aravamudan@canonical.com2016-04-172016-04-192
1571415Selecting auto-login during install fails to set autologin to onuser-setupcyphermox@ubuntu.com2016-04-182016-04-191
1568971Ubuntu Mitaka package fails to upgrade with SyntaxError: Undefined variable: '$helpPanelWidthDefault'.horizoncorey.bryant@canonical.com2016-04-112016-04-198
1570006FFe: Sync ldc 1:0.17.1-1 (universe) from Debian unstable (main)ldcmak@debian.org2016-04-132016-04-196
1571082autopkgtest lxd provider tests fail for 2.0juju-coremichael.hudson@ubuntu.com2016-04-152016-04-194
1425609urllib.urlencode() does not exist for python3lazr.restfulclientcjwatson@ubuntu.com2015-02-252016-04-19419
1571691linux: MokSBState is ignoredlinuxtim.gardner@canonical.com2016-04-182016-04-191
1571791linux: 4.4.0-21.37 -proposed trackerlinuxtim.gardner@canonical.com2016-04-182016-04-191
1546276Install button doesn't show loading bar in Ambience/Radiancegnome-softwarewilliam.hua@canonical.com2016-02-162016-04-1963
1571283Plymouth does not display in ubuntu kylin 16.04 beta2ubuntukylin-themezhangchao@ubuntukylin.com2016-04-192016-04-190
1571284plymouth can not display any messageubuntukylin-themezhangchao@ubuntukylin.com2016-04-192016-04-190
1552539Ubiquity Erase Disk and Install Fails to create Swap Spacecaspermartin.pitt@ubuntu.com2016-03-242016-04-2027
1566590s390x environment is weirdsbuildadconrad@ubuntu.com2016-04-062016-04-1913
1572188"ubuntu-cloudimg-query xenial daily" fails with "confused by argument: xenial"lxcstgraber@ubuntu.com2016-04-192016-04-190
1529450[master] AttributeError: 'PageKde' object has no attribute 'get_secureboot_key'ubiquitycyphermox@ubuntu.com2015-12-272016-04-19114
1561829[FFE] Merge apt-cacher-ng 0.9.1-1 (universe) from Debian unstable (main)apt-cacher-nglogan@ubuntu.com2016-03-252016-04-1925
1565542init scripts don't set console fontsconsole-setupeugenenuke@gmail.com2016-04-032016-04-2017
1549691Improve documentation for the nil pluginsnapcraftsergio.schvezov@ubuntu.com2016-02-252016-04-2055
1558296snappy build-apps broken link to devel ref pagesnapcraftsergio.schvezov@ubuntu.com2016-03-172016-04-2034
1571696snapcraft-coverage fails with 'No module named 'snapcraft.dirs'snapcraftsergio.schvezov@ubuntu.com2016-04-182016-04-202
1572129Exec wrapper uses the wrong expansionsnapcraftsergio.schvezov@ubuntu.com2016-04-192016-04-201
1572186Snapcraft log would be much easier to understand with colorssnapcraftsergio.schvezov@ubuntu.com2016-04-192016-04-201
1524526Crashes with undefined symboldovecotraof@ubuntu.com2015-12-092016-04-22135
1572100Akonadi fresh install fails to start with MySQL 5.7akonadiyofel@kubuntu.org2016-04-192016-04-201
1572427Update to build with MySQL 5.7pinba-engine-mysqllars.tangvald@oracle.com2016-04-202016-04-200
1570230Missing URI ‘help:gnome-user-share/index’gnome-user-sharetim@feathertop.org2016-04-142016-04-206
1541195During installation: language on panels and between panels is mixed (for example: English and Russian)debian-installercjwatson@ubuntu.com2016-04-202016-04-200
1543197Auto Login not set in SDDM during Installuser-setupcyphermox@ubuntu.com2016-04-202016-04-200
1571444Build ngx_mod against LuaJITnginxteward@ubuntu.com2016-04-182016-04-202
1572223[FFe] Update nginx to 1.9.15nginxteward@ubuntu.com2016-04-192016-04-201
1572582sssd_be bombards old IPA server with bogus lookupssssdtjaalton@debian.org2016-04-202016-04-200
1564156xenial: invalid opcode when using llvmpipellvm-toolchain-3.8tjaalton@debian.org2016-04-202016-04-222
1572118kernel plugin _make_initrd fails to add given modulessnapcraftsergio.schvezov@ubuntu.com2016-04-192016-04-201
1572602Support series 16 for downloadssnapcraftsergio.schvezov@ubuntu.com2016-04-202016-04-200
1572664Migrated files don't follow symlinks if they're hard linkedsnapcraftsergio.schvezov@ubuntu.com2016-04-202016-04-200
1572855libgbm.so.1: cannot open shared object filexorg-lts-transitionaltjaalton@debian.org2016-04-212016-04-210
1572039segmentation fault occurred during libica-2.6.1 testslibicaxnox@ubuntu.com2016-04-192016-04-212
1572752improve UTC setting migration on upgradessysvinitsteve.langasek@ubuntu.com2016-04-202016-04-222
1573596yakkety: add new series linkdebootstrapapw@ubuntu.com2016-04-222016-04-220
1573780Update to include yakketydistro-info-datastefanor@ubuntu.com2016-04-222016-04-220
1549660Fix speaker volume on a Dell machinelinuxkamal@canonical.com2016-02-252016-04-0540
1555912The mic mute key and led can't work on a Lenovo AIO machinelinuxkamal@canonical.com2016-03-112016-03-154

A total of 1986 bug tasks were fixed during Xenial!

nish.aravamudan@canonical.com has 242 fixes
tim.gardner@canonical.com has 192 fixes
sergio.schvezov@ubuntu.com has 101 fixes
seb128@ubuntu.com has 76 fixes
martin.pitt@ubuntu.com has 71 fixes
xnox@ubuntu.com has 68 fixes
sergio.schvezov@canonical.com has 61 fixes
robert.ancell@canonical.com has 53 fixes
apw@canonical.com has 50 fixes
doko@ubuntu.com has 41 fixes
stgraber@ubuntu.com has 40 fixes
steve.langasek@ubuntu.com has 39 fixes
james.page@ubuntu.com has 36 fixes
code@flexion.org has 35 fixes
mathieu-tl@ubuntu.com has 35 fixes
serge.hallyn@ubuntu.com has 33 fixes
jamie@ubuntu.com has 33 fixes
tim@feathertop.org has 32 fixes
smoser@ubuntu.com has 28 fixes
brian@ubuntu.com has 28 fixes
apw@ubuntu.com has 24 fixes
locutusofborg@debian.org has 23 fixes
smd.seandavis@gmail.com has 23 fixes
iain@orangesquash.org.uk has 22 fixes
tjaalton@debian.org has 21 fixes
christian.ehrhardt@canonical.com has 21 fixes
marc.deslauriers@ubuntu.com has 19 fixes
cyphermox@ubuntu.com has 18 fixes
tyhicks@canonical.com has 16 fixes
robie.basak@ubuntu.com has 15 fixes
leo.arias@canonical.com has 14 fixes
teward@ubuntu.com has 14 fixes
adconrad@ubuntu.com has 13 fixes
kirkland@ubuntu.com has 13 fixes
gunnarhj@ubuntu.com has 13 fixes
cjwatson@ubuntu.com has 13 fixes
ivan.hu@ubuntu.com has 13 fixes
noskcaj@ubuntu.com has 13 fixes
barry@ubuntu.com has 11 fixes
corey.bryant@canonical.com has 11 fixes
ryan.harper@canonical.com has 11 fixes
mterry@ubuntu.com has 10 fixes
francesco.fumanti@gmx.net has 10 fixes
colin.king@canonical.com has 10 fixes
didrocks@ubuntu.com has 9 fixes
mario_limonciello@dell.com has 9 fixes
stefan.bader@canonical.com has 9 fixes
chris.coulson@canonical.com has 9 fixes
alex.hung@ubuntu.com has 8 fixes
simon.deziel@gmail.com has 8 fixes
zulcss@ubuntu.com has 8 fixes
iain.lane@canonical.com has 8 fixes
bjoern.michaelsen@canonical.com has 8 fixes
ben.howard@ubuntu.com has 8 fixes
yofel@kubuntu.org has 8 fixes
andreas@canonical.com has 7 fixes
themuso@ubuntu.com has 7 fixes
kyle@canonical.com has 7 fixes
pierre-andre.morey@canonical.com has 7 fixes
louis.bouchard@ubuntu.com has 7 fixes
michael.hudson@canonical.com has 7 fixes
timo-jyrinki@ubuntu.com has 6 fixes
dannf@ubuntu.com has 6 fixes
ogra@ubuntu.com has 6 fixes
michael.vogt@ubuntu.com has 6 fixes
chris.j.arges@canonical.com has 6 fixes
logan@ubuntu.com has 5 fixes
alberto.milone@canonical.com has 5 fixes
till.kamppeter@gmail.com has 5 fixes
lars.tangvald@oracle.com has 5 fixes
bryan.quigley@canonical.com has 4 fixes
dariusz.gadomski@canonical.com has 4 fixes
ari-tczew@ubuntu.com has 4 fixes
andreserl@ubuntu.com has 4 fixes
v.ladeuil+lp@free.fr has 4 fixes
gilir@ubuntu.com has 4 fixes
daniel.holbach@ubuntu.com has 4 fixes
ginggs@ubuntu.com has 3 fixes
mcintire.evan@gmail.com has 3 fixes
zhangchao@ubuntukylin.com has 3 fixes
lamont@canonical.com has 3 fixes
lukasz.zemczak@ubuntu.com has 3 fixes
daniel.watkins@canonical.com has 3 fixes
marco@ubuntu.com has 3 fixes
wgrant@ubuntu.com has 3 fixes
unit193@ubuntu.com has 3 fixes
seth.forshee@canonical.com has 3 fixes
ubuntu@desserud.org has 3 fixes
mapreri@ubuntu.com has 2 fixes
clivejo@aol.com has 2 fixes
mauricfo@linux.vnet.ibm.com has 2 fixes
nobuto@ubuntu.com has 2 fixes
lamont.jones@canonical.com has 2 fixes
kamal@canonical.com has 2 fixes
andersk@mit.edu has 2 fixes
william.hua@canonical.com has 2 fixes
raof@ubuntu.com has 2 fixes
a.starr.b@gmail.com has 2 fixes
graham@nerve.org.za has 2 fixes
rossgammon@mail.dk has 2 fixes
michael.hudson@ubuntu.com has 2 fixes
otto@seravo.fi has 1 fix
chiluk@canonical.com has 1 fix
brandontschaefer@gmail.com has 1 fix
stevenk@ubuntu.com has 1 fix
ikuya@fruitsbasket.info has 1 fix
sgclark@kubuntu.org has 1 fix
rhansen@rhansen.org has 1 fix
michal.strnad@nic.cz has 1 fix
scott@kitterman.com has 1 fix
jorge.niedbalski@canonical.com has 1 fix
software@tim-hollmann.de has 1 fix
stephen.webb@canonical.com has 1 fix
persia@ubuntu.com has 1 fix
joy.latten@canonical.com has 1 fix
lukasz.zemczak@canonical.com has 1 fix
marco@ceppi.net has 1 fix
curtis.hovey@canonical.com has 1 fix
paolo.pisati@canonical.com has 1 fix
monsta@inbox.ru has 1 fix
hyperair@debian.org has 1 fix
JohnSGruber@gmail.com has 1 fix
lars.uebernickel@ubuntu.com has 1 fix
freyja-dev@lists.launchpad.net has 1 fix
tianon@debian.org has 1 fix
subins2000@gmail.com has 1 fix
stef.ahlers@t-online.de has 1 fix
ricotz@ubuntu.com has 1 fix
shuilupi@ubuntukylin.com has 1 fix
ryan@nardis.ca has 1 fix
info@g-com.eu has 1 fix
dan.streetman@canonical.com has 1 fix
chad.miller@canonical.com has 1 fix
robert.jennings@ubuntu.com has 1 fix
stefanor@ubuntu.com has 1 fix
ddv@canonical.com has 1 fix
free.ekanayaka@canonical.com has 1 fix
happyaron@ubuntu.com has 1 fix
utlemming.howard@ubuntu.com has 1 fix
mak@debian.org has 1 fix
billy.olsen@canonical.com has 1 fix
eugenenuke@gmail.com has 1 fix
ken.vandine@canonical.com has 1 fix
sylee@canonical.com has 1 fix
slashd@ubuntu.com has 1 fix
tg@mirbsd.de has 1 fix
laney@debian.org has 1 fix
d.filoni@ubuntu.com has 1 fix
eric.desrochers@canonical.com has 1 fix
jrivero@osrfoundation.org has 1 fix
mty.shibata@gmail.com has 1 fix