Open bugs with attachments flagged as patches

These bugs have an attachment that are flagged as a patch. All of the column headers are sortable give them a click!

SummaryInImportanceStatusAttachment NameAttachment Extension
999743warning in I.h from gcc 4.6.3 with -WallnanaUndecidedNewFix "deprecated conversion from string constant to 'char*'" warning.dpatch
999146Merge 3.12.1 with Debian unstablegladeWishlistConfirmedglade_3.12.1-1ubuntu1.debdiffdebdiff
998837acroread fails to install on amd64acroreadUndecidedNewacroread_multiarch_supportpatch
998612zhcon KSC and JIS support somewhat brokenzhconUndecidedNewImprove zhcon KSC and JIS supportdiff
998610Does not work because file command changed its outputsqldeveloper-packageUndecidedNewbug#998610.patchpatch
998403ntp in precise has disabled cryptontpHighTriagedfix detection of openssldiff
998258make-sqldeveloper-package: dh options is deprecatedsqldeveloper-packageUndecidedNewmake-sqldeveloper-package.patchpatch
997880debian/watch doesn't workcortinaUndecidedIn Progressdebian/watch: fix the base URLpatch
997508In all blindness and low vision profiles need turning off Nautilus sidebarcasperUndecidedConfirmedPatch with hide this issue only low vision and blindness accessibility profilespatch
997456AM_PATH_PYTHON regressionautomake1.11UndecidedNewAM_PATH_PYTHON-destdir-support.debdiffdebdiff
997212Openbox crashing X.org, running GTK 3.4 applications. openboxUndecidedConfirmed50_gtk43bugfix.patchpatch
997063xen-create-image fails to effectively prevent daemon startup on roles executionxen-toolsUndecidedIn Progressxen-tools_common.sh.patchpatch
996691Pidgin may be vulnerable to remote MSN and XMPP crashespidginMediumTriagedpidgin_2.10.4-0ubuntu1.debdiffdebdiff
996250input device names used in logging format stringsxorg-serverUndecidedNewxorg-server_1.11.4-0ubuntu10.2.debdiffdebdiff
995747Gedit: Remove trailing spaces feature removes last line.gedit-pluginsUndecidedConfirmedgedit-externaltools-capture.py-process_read_buffer-source-parameter.patchpatch
995558ubuntu 11.10 not fully installedubiquityUndecidedNewubiquity-gtkui.desktopdesktop
995521dput warnings if there are spaces in pathdputUndecidedNewdput.diffdiff
995435Zenity --list uses 100%cpu and does nothingzenityHighTriagedgit_list_view_segfault.patchpatch
995163zcache should be built-in instead of kernel modulelinuxUndecidedConfirmed0001-Set-CONFIG_ZCACHE-to-y.patchpatch
995163zcache should be built-in instead of kernel modulelinuxUndecidedConfirmed0002-staging-zcache-make-zcache-builtin-only.patchpatch
994888Unrecoverable crash when suspending from inside a virtual machinexserver-xorg-video-vmwareMediumConfirmedprecise debdiffdebdiff
994888Unrecoverable crash when suspending from inside a virtual machinexserver-xorg-video-vmwareMediumConfirmedquantal debdiffdebdiff
994842texlive-lang-french: misbehaviour of "et al." function in plainnat-fr styletexlive-langUndecidedNewplainnat-fr.bstbst
994752lxc-start-ephemeral's use of dhcp lease table is fragilelxcHighTriagedbug-994752-lxc-ip.debdiffdebdiff
994255bcmwl-kernel-source 5.100.82.38+bdcom-0ubuntu6.1: bcmwl kernel module failed to build [fatal error: asm/system.h: No such file or directory]bcmwlHighConfirmed0005-add-support-for-linux-3.4.0.patchpatch
993867Xoscope package lacks pulseaudio-esound-compat as dependencyxoscopeUndecidedNewesd_compat_dep.patchpatch
993770Precise's shell-windows-switching.page still mentions "Windows" keyubuntu-docsUndecidedIn Progressbug993770.diffdiff
993571Wifi disconnect/reconnects fairly often (from multiple times an hour to multiple times per day) because of ip-config-unavailablenetwork-managerUndecidedNewnm-ip6-rs.patchpatch
993427fglrx 2:8.960-0ubuntu1: fglrx kernel module failed to build [error: ‘cpu_possible_map’ undeclared (first use in this function)]fglrx-installerHighTriaged34.patchpatch
992941Remove wxwidgets2.6wxwidgets2.6LowConfirmedxaralx.debdiffdebdiff
992797control file should include "Multi-Arch: foreign"xdg-utilsUndecidedNewadd Multi-Arch: foreign to debian/control filepatch
992054APT needs a patch to become free-software-friendly aptUndecidedConfirmedfix-source-list-example-restricted.patch.txttxt
992012No /openssl.cnf file could be found because of a wrong regex in whichopensslcnfopenvpnUndecidedConfirmedMake the trailing alpha numeric character of the version string optionalpatch
992012No /openssl.cnf file could be found because of a wrong regex in whichopensslcnfopenvpnUndecidedConfirmedwhichopensslcnf-patch.txttxt
991180Ubuntu 12.04 Nvidia Compiz Expo MipmapcompizUndecidedConfirmedReport mipmap-awareness of FBConfigs regardless or whether FBOs are known to be supported or notpatch
990635Sans serif cyrrilic font in kubuntu 12.04 is badkdebaseUndecidedConfirmedThis patch fixes bad cyrillic 'sans-serif' and 'serif' BUT is not tested with korean localizationpatch
990635Sans serif cyrrilic font in kubuntu 12.04 is badqt4-x11UndecidedConfirmedThis patch fixes bad cyrillic 'sans-serif' and 'serif' BUT is not tested with korean localizationpatch
990557Cannot add a new entry string field, "name already exists" errorkeepass2MediumTriaged0001-fix-double-onclick-event.patchpatch
990302Scrolling for embedded Gtk+ widgets is broken in Clutterclutter-1.0HighTriagedDebdiff for precise-proposedpatch
990141document ssp-buffer-size defaultgcc-4.7UndecidedNewssp-doc.patchpatch
989998incomplete dkms package dependenciesdkmsUndecidedIn ProgressAdd 'dpkg-dev' and 'debhelper' to Depends in debian/controlpatch
989946Incorrect translationhelloUndecidedIn Progresspatchpatch
989814Albatross: GTK3 apps are hard to read (white on light grey)shimmer-themesUndecidedConfirmedalbatross gtk3 patchpatch
989814Albatross: GTK3 apps are hard to read (white on light grey)shimmer-themesUndecidedConfirmedsame patch as above just it is the entire filegz
989675names_cache memory leak in unionfs modulelinux-ubuntu-modules-2.6.24UndecidedNewPatch for unionfs memory leakpatch
989626Danish Dvorak keyboard layout missing tildexkeyboard-configMediumTriagedPatch to fix DK Dvorak in 12.04patch
989445shorewall ignores local configuration when reading remote configurationshorewallUndecidedNewmove reading the configuration before the call to rsh_commandpatch
989252pylint-gui throws exception when running file or packagepylintUndecidedConfirmedpylint-gui-fix.patchpatch
989242Add adm group to /var/log/novanovaLowTriagednova_2012.1.debdiffdebdiff
989241Give nova group read permissions nova files / directoriesnovaLowTriagednova_2012.1.debdiffdebdiff
989205Give glance group read permission to /etc/glanceglanceLowTriaged989205.debdiffdebdiff
988889[packaging] hard dependency on mysql backend, breaks other programsakonadiUndecidedConfirmedExample of akonadi-server dependency changes to introduce an 'akonadi-backend' virtual packagediff
988881/etc/init.d/clvm status exitcode always 0lvm2UndecidedNewclvm-patch.diffdiff
988780polipo index does not show all cache entriespolipoUndecidedNewpolipo-index-fix.patchpatch
988520After failed auth, subsequent auths in same context failkrb5MediumTriagedkrb5.debdiffdebdiff
988512Missing /boot/vmcoreinfo-{version} file is breaking kdumplinuxMediumIn Progress0001-UBUNTU-Config-Build-vmcore-for-x86.patchpatch
988394Reboot hangs because /etc/rc6.d/S40umountfs chokes on non-existent mountsautofs5HighNewumountfs.diffdiff
988365Usb_modeswitch doesn't switch when wader is installedwaderUndecidedConfirmed0001-Udev-rule-update-be-more-like-MM-avoids-usb_modeswit.patchpatch
988183Logs full with "ICMPv6 RA: ndisc_router_discovery() failed to add default route"network-managerHighIn Progressdebdiff to network-manager-0.9.4.0 (0.9.4.0-0ubuntu3)debdiff
988183Logs full with "ICMPv6 RA: ndisc_router_discovery() failed to add default route"network-managerHighIn Progressnetwork-manager-0.9.4.0-0ubuntu4.1~dileks1.debdiffdebdiff
988043nmap has no debian/watch filenmapUndecidedIn ProgressPatch to add watch filepatch
987284Change unity-2d test to file testnuxUndecidedConfirmednux-snowball.patchpatch
987280Add cross-compile and parallel build support to nuxnuxUndecidedConfirmednux.crosscompile.patchpatch
986186software center stop working when I select system software for a long timegtk+3.0LowTriagedcrude-workaround.diffdiff
985981Ubuntu patch fo "Add ufw integration"moshUndecidedConfirmedmosh-1.1.3.debdiffdebdiff
985845About use "sox" in "Linux Educational", brazilian distribution for elementary school teathersoxUndecidedNewMessage from apt-get install soxpng
985810make-sqldeveloper-package failed to build: chmod: missing operand after `755'sqldeveloper-packageUndecidedConfirmedPatch to grep for result string from updated file/magicdiff
985508dpkg-maintscript-helper 'mv_conffile' fails if target doesn't already existdpkgUndecidedNewdpkg-maintscript-helper.patchpatch
985346Resume fails if kernel swsusp method is not configureduswsuspUndecidedNewPatch for boot script initramfs-tools/scripts/local-premount/uswsusp0+20110509-diff
983927[usability regression] Adding applets to gnome-panel has become hardergnome-panelUndecidedConfirmedallow to edit the applets without modifier keyspatch
983927[usability regression] Adding applets to gnome-panel has become hardergnome-panelUndecidedConfirmedallow to edit the panel without modifier keyspatch
983927[usability regression] Adding applets to gnome-panel has become hardergnome-panelUndecidedConfirmedalso remove modifier keys for applets that use libpanelpatch
983927[usability regression] Adding applets to gnome-panel has become hardergnome-panelUndecidedConfirmedenable moving a non-expanded panel without modifier keys againpatch
983927[usability regression] Adding applets to gnome-panel has become hardergnome-panelUndecidedConfirmedenable moving applets with the middle mouse button againpatch
983805Resume boot script fix makes /bin/resume unnecessary (kernel's internal swsusp)initramfs-toolsUndecidedNewPatch (replaces one in post #6)v5
983805Resume boot script fix makes /bin/resume unnecessary (kernel's internal swsusp)initramfs-toolsUndecidedNewPatch file for frozen versionv6
983805Resume boot script fix makes /bin/resume unnecessary (kernel's internal swsusp)initramfs-toolsUndecidedNewPatch with further updatesv3
983805Resume boot script fix makes /bin/resume unnecessary (kernel's internal swsusp)initramfs-toolsUndecidedNewResume boot script makes /bin/resume superfluousinitramfs-tools-resume-boot-script-diff
983805Resume boot script fix makes /bin/resume unnecessary (kernel's internal swsusp)initramfs-toolsUndecidedNewUpdated patch --- please discard previous versionv2
982961"RATEEST" and "statistic" modules are broken iptablesUndecidedNewxtables-lm-noasneeded.patchpatch
982886selected input in the gnome input selector is not the input that mumble usesmumbleUndecidedTriaged0006-pulseaudio-default-inout.patchpatch
982687libSDL crashes with a segfault when using smpeglibsdl1.2UndecidedConfirmedAsGmpwwN.txttxt
982478New USB webcam device id to be listed in gspca pac7302linuxMediumIn ProgressPathcfile that adds support for webcam 0x093a, 0x2627 for gspca/pac7302diff
981966Beagleboard XM: sysfs always reports link present for eth0 at bootlinuxMediumIn Progress0001-smsc95xx-mark-link-down-on-startup-and-let-PHY-inter.patchpatch
980963Heap-based Buffer Overflow in libavcodeclibavMediumTriaged0001-vqavideo-return-error-if-image-size-is-not-a-multipl.patchpatch
980756xfce4-places-plugin does not respect preferred file managerxfce4-places-pluginUndecidedConfirmedFix preferred file manager (deb patch)patch
980291In Xen domU, "facter virtual" prints "physical"facterMediumConfirmedxen-detection-fixxen-detection-fix
980180Apache RA doesn't create /var/run/apache2 [SRU]cluster-agentsUndecidedConfirmedresource-agents-apache.debdiffdebdiff
980180Apache RA doesn't create /var/run/apache2 [SRU]resource-agentsHighConfirmedresource-agents-apache.debdiffdebdiff
979060Mutt should be able to set screen/tmux window titlemuttUndecidedNewScreen titles patchstitles
979003libc incorrectly detects AVX supporteglibcMediumConfirmedeglibc_lucid_fix979003.debdiffdebdiff
978973error in string #2129ubuntu-docsUndecidedIn Progressbug978973.diffdiff
978895Checkbox Should Not Use gconfsink for SoundcheckboxMediumTriagedgstpatch2patch
978446Wrong filename in license of 'spider.c'ace-of-penguinsLowConfirmedDebdiff: fix filename in spider.c's licensedebdiff
978446Wrong filename in license of 'spider.c'ace-of-penguinsLowConfirmedRegular patch: fix filename in spider.c's licensepatch
978228Multiarch support for libpaper libpaperUndecidedConfirmedlibpaper-1.1.24+nmu1build1-multiarch.patchpatch
978172"wajig status" gives warning message about stdin not sortedwajigUndecidedNewwajig.status.patchpatch
977952Please transition libbonoboui to multi-archlibbonobouiUndecidedConfirmedlibbonoboui_2.24.5-0ubuntu2.debdiffdebdiff
977940Please transition gnome-vfs to multi-archgnome-vfsUndecidedConfirmedgnome-vfs_2.24.4-1ubuntu3.debdiffdebdiff
977526Manpage makes erroneous claim about BROWSER documentationsensible-utilsUndecidedIn ProgressAdd description of BROWSER variabledebdiff
976883Invalid cdrdao toc filegwcUndecidedNewSorry! forgot to use the right options with diff.patchfile
976883Invalid cdrdao toc filegwcUndecidedNewdiff of bug fix against markers.c in gwc version 0.21-16patchfile
976883Invalid cdrdao toc filegwcUndecidedNewpatched source for markers.cc
975941[soundnua]: Spurious "Digital Output S/PDIF" output entry for USB headsetalsa-libLowConfirmed0001-alsa-lib-conf-block-S-PDIF-access-for-Sennheiser-USB.patchpatch
975899"Switch between windows" section incorrectly states that window previews will be shownubuntu-docsUndecidedIn Progressbug975899.diffdiff
975890"Maximize and unmaximize a window" section refers to "Windows key"ubuntu-docsUndecidedIn Progressbug975890.diffdiff
975841gwibber-service crashed with error in read(): [Errno 104] Connection reset by peergwibberLowTriagedpatch.diffdiff
975793'aptitude safe-upgrade -d -y' enters infinite loopaptitudeUndecidedConfirmed0001-Avoid-dpkg-and-infinite-loop-in-download-only-mode.patchpatch
975689X freezes completely running google earth on xserver-xorg-video-intel - IPEHR: 0x7a000002linuxMediumTriagedpatch for 3.2diff
975689X freezes completely running google earth on xserver-xorg-video-intel - IPEHR: 0x7a000002xserver-xorg-video-intelHighTriagedpatch for 3.2diff
975356Logging from signal context is unsafexorg-serverMediumIn ProgressProposed fix for signal-unsafe loggingpatch
975356Logging from signal context is unsafexorg-serverMediumIn ProgressProposed fix for signal-unsafe logging v2patch
975029bindings to activate ezoom not setcompiz-plugins-mainUndecidedConfirmedezoom-bindings.patchpatch
974242Compiz edge detection code is moving windows against my willcompizUndecidedConfirmedfix-974242.patchpatch
974132[backportpackage] please support backporting to Debian stableubuntu-dev-toolsWishlistNewbackportpackage-debian.patchpatch
974038gtimer segfaults at startup (precise)gtimerUndecidedNewpatch to fix startup segfaultpatch
973430Readonly textview widgets visualy impaired users unable to read with arrow keys with screen readercheckboxUndecidedNewCaretnavigation fix for Checkbox GTK interfacepatch
973241ipw2200 driver doesn't report any capabilities or wireless properties using the nl80211 interface to network-managerlinuxMediumTriagedipw2x00-no-nl80211.patchpatch
973241ipw2200 driver doesn't report any capabilities or wireless properties using the nl80211 interface to network-managerlinuxMediumTriageduse-wext-for-ipw2200.patchpatch
972834atftpd: invalid IP addressatftpUndecidedConfirmedtftpd.c-defined_port.patchpatch
972692"ucarp --neutral" via /etc/network/interfacesucarpUndecidedNewPatch for /etc/network/if-up.d/ucarptxt
972371Invest Applet fails to open menu optionsgnome-appletsUndecidedNewapplet.pypy
972166[HDA-Intel - HDA Intel, playback] Background noisealsa-driverUndecidedNewI managed to make codec Realtek ALC889 work making a few tweaks with HDA_Analyser, now I just need to know how to make these changes permanentdiff
971972Typo in manpage - no ending parentheseshibernateLowTriagedAdd closing parentheses to hibernate.conf manpagedpatch
971867No voice call or video call possible, due to recent farsight->farstream transitionpidginUndecidedNewpidgin-farstream-ubuntu-precise.patchpatch
971383Converting files from .flac to .m4a fails in pacpl 4.0.5: Error code 256pacplUndecidedNewThis patch fixes it for me. The patch uses two files pacpl.pl and pacpl.pl.new. Adjust those names to your needs.patch
971240Won't load in 12.04 (beta 2)gwaeiUndecidedConfirmedFix the 2 problems (freeze window and no main menu)patch
971240Won't load in 12.04 (beta 2)gwaeiUndecidedConfirmeddebian_sid_gwaei-3.2.0b1-3.patchpatch
971240Won't load in 12.04 (beta 2)gwaeiUndecidedConfirmeddebian_sid_gwaei-3.4.3-2.patchpatch
971240Won't load in 12.04 (beta 2)gwaeiUndecidedConfirmedgwaei_ubuntu12.04.patchpatch
971240Won't load in 12.04 (beta 2)gwaeiUndecidedConfirmedreparent.patchpatch
971224[HP Pavilion dv6 Notebook PC, IDT 92HD81B1X5, Speaker, Internal] No bass, only 2/4 speakers workingalsa-driverUndecidedConfirmedDiff from hda_analyzerdiff
971098Restarting unity shows two psensor icons in the unity barpsensorUndecidedNewLP971098.diffdiff
971091Pandaboard ES freezes with the default CPU scaling governor ondemandlinux-ti-omap4MediumConfirmedomap4460-fix-lack-of-mpu-dpll-bypass.patchpatch
970581[FIX] AutoKey (GTK) is not useable by default in Ubuntu 12.04autokeyUndecidedNewBash script to detect whether Autokey is in the whitelist and add it if it isn't.sh
970218Application needs hi-res or SVG icon rapidsvnLowTriagedrapidsvn iconsvg
969733oss4-dkms 4.2-build2005-2ubuntu1: oss4 kernel module failed to build (cp: cannot stat `/lib/modules/3.2.0-23-generic/source/include/linux/limits.h': No such file or directory)oss4UndecidedConfirmeddkmspatch.txttxt
969497In /usr/share/applications/firefox.desktop Name[pl] entry for [NewWindow Shortcut Group] is missingfirefoxUndecidedNewFixed file which contains previously missing Name[pl] entrydesktop
969425Mutter 3.3.92 or higher crashes when windows were minimizedmutterUndecidedNewfix-crash-on-minimized-window.patchpatch
968752Bug prevents flash plugin to load during firefox sessions. Audit logs are provided. Known update to firefox profile may help; wondering if it is secure?apparmorUndecidedNew/etc/apparmor.d/usr.bin.firefoxfirefox
967138Ubuntu Studio fr.po is not translated in frenchubiquity-slideshow-ubuntuUndecidedNewFrench translation for the Ubuntu Studio slideshowdebdiff
96679319disable_sslv2 patch breaks TLSv1.1irssiUndecidedNewirssi-r5136.patchpatch
96679319disable_sslv2 patch breaks TLSv1.1irssiUndecidedNewrevised patch to disable SSLv2 without downgrading the security of OpenSSLpatch
965786Typo in manpage '---note-path'tomboyUndecidedConfirmedFix manpage typo '---note-path'patch
965786Typo in manpage '---note-path'tomboyUndecidedConfirmedtomboy_1.10.0-1ubuntu2.debdiffdebdiff
965772mutt-org crashed with SIGSEGVmuttMediumConfirmedmutt_1.5.21-5ubuntu3.debdiffdebdiff
965645Error starting ConVirtpython-repoze.what-pluginsMediumTriagedpossible compat fixdebdiff
964497GIF loader uses about 280M of VmRSS for a 200Kb GIFgdk-pixbufUndecidedNewfix memory usagecgi?id=204837
964497GIF loader uses about 280M of VmRSS for a 200Kb GIFgdk-pixbufUndecidedNewpatch.diffdiff
963254PHP code throws warnings unnecessarily in several placesamavis-statsUndecidedNewPatch to resolve PHP warnings in amavis-statsdiff
963036No audio in tvtime with a PixelView PlayTV USB Hybrid (cx231xx) devicetvtimeUndecidedConfirmedfix the bug by adding a check for cx231xx in audiolib.cdiff
962921spaces not supported in authentication datacorkscrewUndecidedNewFix space handling in authentication data.diff
962860The prompt for installing MP3 playback support dialogue box does not fit in a 1024x600 displaylibubuntuoneHighTriagedlibubuntone-shorten-mp3install-message-against-trunk.diffpatch
962860The prompt for installing MP3 playback support dialogue box does not fit in a 1024x600 displaylibubuntuoneHighTriagedlibubuntone-shorten-mp3install-message.diffdiff
962718mount_afp fails with "Could not connect, never got a response to getstatus, Connection timed out" errorafpfs-ngUndecidedConfirmedThe patch that fixes the timeout problemdiff
961240cloud-init does not run grub on PV Xen and KVM has issuescloud-initLowNewuntested patch to fix loop over devicespatch
961166lb_binary_disk doesn't check compression of the initramfslive-buildMediumTriagedlive-build-package.patchpatch
961166lb_binary_disk doesn't check compression of the initramfslive-buildMediumTriagedlive-build.patchpatch
961166lb_binary_disk doesn't check compression of the initramfslive-buildMediumTriagedreal-live-build.patchpatch
960967eog crashed with SIGSEGV in do_rot_270()eogMediumIn Progress03_initjpegtransform.patchpatch
960967eog crashed with SIGSEGV in do_rot_270()eogMediumIn Progresslibjpeg-turbo updatedebdiff
960967eog crashed with SIGSEGV in do_rot_270()libjpeg-turboMediumTriaged03_initjpegtransform.patchpatch
960967eog crashed with SIGSEGV in do_rot_270()libjpeg-turboMediumTriagedlibjpeg-turbo updatedebdiff
960079race condition in USR1 signal handling in mountallmountallUndecidedNewinstall the USR1 signal handler before daemonisingpatch
959842root escalation via /dev/nvidia0nvidia-graphics-drivers-173UndecidedConfirmedPatch for 195 and earlierdiff
959842root escalation via /dev/nvidia0nvidia-graphics-drivers-173UndecidedConfirmedPatch for 256-285diff
959842root escalation via /dev/nvidia0nvidia-graphics-drivers-173UndecidedConfirmedPath for 290-295diff
959842root escalation via /dev/nvidia0nvidia-graphics-drivers-173UndecidedConfirmedpatch for 96patch
959842root escalation via /dev/nvidia0nvidia-graphics-drivers-173-updatesUndecidedConfirmedPatch for 195 and earlierdiff
959842root escalation via /dev/nvidia0nvidia-graphics-drivers-173-updatesUndecidedConfirmedPatch for 256-285diff
959842root escalation via /dev/nvidia0nvidia-graphics-drivers-173-updatesUndecidedConfirmedPath for 290-295diff
959842root escalation via /dev/nvidia0nvidia-graphics-drivers-173-updatesUndecidedConfirmedpatch for 96patch
959812conntrackd manpage fixesconntrackUndecidedNewmanpage fixes for conntrackddiff
959604[public] bad: scheduling from the idle thread!linux-armadaxpHighConfirmed0001-DSMP-fix-the-bad-scheduling-from-the-idle-thread-mes.patchpatch
959604[public] bad: scheduling from the idle thread!linux-armadaxpHighConfirmedfix the "bad: scheduling from the idle thread" errorpatch
959308kvm does not generate a system uuid by defaultqemu-kvmHighConfirmedqemu-uuid.debdiffdebdiff
959308kvm does not generate a system uuid by defaultwhoopsie-daisyUndecidedNewqemu-uuid.debdiffdebdiff
959260DSO linking issuescompiz-plugins-mainMediumTriaged100_fix_pc_files.patchpatch
959260DSO linking issuescompiz-plugins-mainMediumTriaged101_add_missing_link_libraries.patchpatch
959260DSO linking issuescompiz-plugins-mainMediumTriaged103_ring_requires_text.patchpatch
959221swift consumes over 100% of cpu during uploadswiftMediumConfirmedpatch 2, test workarounddiff
959218[SRU] clvm start error missing /var/run/lvmlvm2UndecidedConfirmedlvm2.patchpatch
957519auditctl uses wrong syscall to determine uidauditUndecidedNewChange getuid() to geteuid()patch
956855GtkFileChooserButton dialog stretched, when user has a really long name saved to bookmark gtk+3.0LowTriagedpatchpatch
956051libc6 crash while running 'xm'eglibcUndecidedConfirmedfma4-depends-avx.diffdiff
955455Typo in package descriptionsugar-0.90UndecidedConfirmedFix typo "low-ressource" to "low-resource" in debian/controlpatch
955402Recommendations on their own screen are differently ordered from the home screensoftware-centerLowTriagedsomething like this should work (but more proof of concept for now)diff
954661backlight brightness not adjustable by default on Dell XPS 13linuxMediumIn Progress0001-drm-i915-i915.enable_backlight-0-disables-intel_back.patchpatch
954661backlight brightness not adjustable by default on Dell XPS 13linuxMediumIn Progress0002-drm-i915-quirk-disable-i915-backlight-on-Dell-XPS-13.patchpatch
954368Upstart script puppet agentpuppetWishlistConfirmeddebdiff for puppetdebdiff
954352Enable wayland backendgtk+3.0WishlistConfirmedgtk+3.0_3.4.1-0ubuntu1.dsc-gtk+3.0_3.4.1-0ubuntu1+wayland2.dsc.debdiffdebdiff
954109ALPS driver lacks semi-MT support for "v4" touchpadslinuxWishlistConfirmedALPS v4 semi-mt support patch (buggy) v2patch
953768man page has typoclipfUndecidedNewpatch.debdiffdebdiff
952661Km in the units tab should be written in full as kilometresindicator-weatherLowTriagedkmpatch.debdiffdebdiff
951827Power Statistics window blankgnome-power-managerUndecidedConfirmedfix.patchpatch
951043Port OOM changes into do_page_fault for armlinuxMediumConfirmed0001-ARM-7178-1-fault.c-Port-OOM-changes-into-do_page_fau.patchpatch
951043Port OOM changes into do_page_fault for armlinuxMediumConfirmedlinux-2.6.git-8878a539ff19a43cf3729e7562cd528f490246ae.patchpatch
951043Port OOM changes into do_page_fault for armlinux-ti-omap4MediumConfirmed0001-ARM-7178-1-fault.c-Port-OOM-changes-into-do_page_fau.patchpatch
951043Port OOM changes into do_page_fault for armlinux-ti-omap4MediumConfirmedlinux-2.6.git-8878a539ff19a43cf3729e7562cd528f490246ae.patchpatch
950867problem in smbios-utils. some tokens not recognizedlibsmbiosUndecidedConfirmedlibsmbbios_backport_lp950867.debdiffdebdiff
950867problem in smbios-utils. some tokens not recognizedlibsmbiosUndecidedConfirmedlibsmbbios_backport_lp950867_2.debdiffdebdiff
950074"quickly configure dependencies" fails when gedit is runningquicklyUndecidedNewrun gedit with --standalone argumentpatch
949942Package description is incorrectgtestLowConfirmedfix-for-949942.debdiffdebdiff
949126[Regression] X resources take no effectemacs23UndecidedConfirmedemacs.desktop_alternatives.patchpatch
949126[Regression] X resources take no effectemacs23UndecidedConfirmedemacs.desktop_alternatives_V2.patchpatch
948914Cortina 07.3 in Precise is not workingcortinaUndecidedConfirmedDifference between 0.7.3 and 1.0.00
948323Rom images for e1000 and ne2k missing vendor and device idipxeLowConfirmedProposal for modifying the ROM names.debdiff
947892Scrolling ncurses app in xfce4-terminal with mouse wheel not workingxfce4-terminalUndecidedConfirmedMake scroll alternate screen toggleable for xfce4-terminalpatch
947668hostapd wired 802.1x is brokenhostapdUndecidedConfirmedwired_eapol.patchpatch
947296Update-manager stopped updatingupdate-managerUndecidedConfirmedcorrected the distro entrieslist
946736missing openjdk-6-java.desktop fileopenjdk-6MediumTriaged.desktop files from oneiric modified for precise and openjdk 7zip
946660Remove loop-aes-utils from ConflictsfuseUndecidedConfirmedfuse_2.8.6-2ubuntu3.debdiffdebdiff
946631Overlay scrollbars causing input boxes to be smallinkscapeLowTriagedDiff between r11050 and r11049 of lp:inkscape to fix this bugpatch
946232[Dell Inspiron (MM061, MXC051), SigmaTel STAC9200] Missing speaker portpulseaudioUndecidedIn Progress0001-Add-special-profiles-for-some-older-Dell-laptops-STA.patchpatch
946045pybliographer can't search MEDLINE due to change in search URLs.pybliographerUndecidedNewRetrieved from http://pybliographer.git.sourceforge.net/git/gitweb.cgi?p=pybliographer/pyblio-1.2;a=commit;h=07cfd828f846366f1259c12d221311b720a32da0patch
945330vloopback-source does not compile on oneiricvloopbackUndecidedConfirmedvloopback_oneiric.patchpatch
945135043_ubuntu_menu_proxy.patch does not buildgtk+2.0UndecidedNewfix-ubuntumenuproxy-build.patchpatch
944929psb_gfx boot hang on Atom N2600 (GMA3600 Cedarview)linuxHighTriagedgma500.patchpatch
944929psb_gfx boot hang on Atom N2600 (GMA3600 Cedarview)linuxHighTriagedpsb_gfx_cdv.patchpatch
944802Wrong application icon in UnitypadreUndecidedNewpadre.patchpatch
944585warnings from valgrind about openssl as used by CPythonpycryptoppUndecidedNewcpython-openssl101.suppsupp
944295pasuspender does not stop alsa-lib from defaulting to pulseaudio pluginalsa-pluginsWishlistNewPatch against alsa-pluginspatch
944295pasuspender does not stop alsa-lib from defaulting to pulseaudio pluginalsa-pluginsWishlistNewPatch against pulseaudiopatch
944295pasuspender does not stop alsa-lib from defaulting to pulseaudio pluginpulseaudioWishlistConfirmedPatch against alsa-pluginspatch
944295pasuspender does not stop alsa-lib from defaulting to pulseaudio pluginpulseaudioWishlistConfirmedPatch against pulseaudiopatch
942702typo: 'Show "desktop icon"' -> '"Show desktop" icon'unityLowIn Progresstypo fix.patch
942534virt-manager doesn't mention LTS in versionsvirtinstMediumIn Progressvirtinst-lts.debdiffdebdiff
942534virt-manager doesn't mention LTS in versionsvirtinstMediumIn Progressvirtinst.debdiffdebdiff
942106software raid doesn't assemble before mount on bootmdadmHighConfirmedmdadm.patchpatch
941376Only one user on a computer can play html5/webm videofirefoxUndecidedNewPatch to fix caching problemspatch
941074double-click speed too high for Window Title-Bar lubuntu-default-settingsUndecidedConfirmedopenbox.patchpatch
940374infinite loop if deborphan returns packages that are not installedupgrade-systemUndecidedNewupgrade-system_kludge_for_Precise.patchpatch
939867apt-get crashed with SIGSEGV in Name()aptMediumIn Progressapt_apport-nullcheck.patchpatch
939863Warning message from ffmpeg program needs updatelibavLowIn Progresslibav-debdiff.diffdiff
939863Warning message from ffmpeg program needs updatelibavLowIn Progresslibav-now-uses-avconv-ubuntu.patchpatch
939379"Unexpected remote arg" errorubumirrorUndecidedNewFix "Unexpected remote arg" error: "$UBUARC_EXCLUDE" already contains "--exclude".patch
937522rdp clipboard sync doesn't work anymore.remminaUndecidedConfirmedremmina_clipboard.debdiffdebdiff
937522rdp clipboard sync doesn't work anymore.remminaUndecidedConfirmedremmina_clipboard2.debdiffdebdiff
937334Unity shortcut overlay needs to include shortcut for video lensunityLowTriagedPatch to add the shortcut for video lensdiff
937055patch to mount crypted persistent data fileslive-initramfsUndecidedNewpatch to function fond_cow_device() in live-helpers1-1
936840 key now known as which breaks keyboard shortcutslibcompizconfigUndecidedConfirmedAdd as ControlMask, along with patch
936661parted should create Linux filesystem partitions with Linux-specific type codepartedUndecidedNewThe patch against parted 3.0 to fix this problemdiff
935891bsdmainutils should use update-alternatives for hd symlinkbsdmainutilsUndecidedNewuse update-alternatives to manage /usr/bin/hdpatch
935525libglib-perl version 2:1.241-1 FTBFS on i386 in preciselibglib-perlHighConfirmedlengthen the timeout, so the test passes for slower processorsfix-timeout
935493xneur version 0.15.0-1 FTBFS on i386 in precisexneurHighNewQuick fix for 'xkeycodetokeysym'patch
935440setools version 3.3.6.ds-7.2ubuntu4 FTBFS on i386 in precisesetoolsHighNewsetools.diffdiff
934471vlc crashed with SIGSEGV in dvdnav_describe_title_chapters()libdvdnavMediumTriagedcellnr.patchpatch
934471vlc crashed with SIGSEGV in dvdnav_describe_title_chapters()libdvdnavMediumTriagedlibdvdnav-searching.c-check-cellnr-before-indexing.patchpatch
934445hits g_assert (device->priv->styli) when my Wacom Bamboo 2FG 4x5 is plugged ingnome-settings-daemonHighTriagedlibwacom-tablet-description-fix.patchpatch
934222mythtvfs does not work with new version of MythTVmythtvfs-fuseUndecidedConfirmedQuick Hack to update to current protocol version.diff
934123[FFe] Low visibility impaired users can't easily disable overlay scrollbarsunity-greeterUndecidedNewadd_ubuntu-overlay-scrollbars.patchpatch
934123[FFe] Low visibility impaired users can't easily disable overlay scrollbarsunity-greeterUndecidedNewdisable_ubuntu-overlay-scrollbars_for_a11y.patchpatch
933943rsyslogd please apply patch for large group handlingrsyslogMediumTriaged0001-call-getgrnam_r-repeatedly-to-get-all-group-members.patchpatch
933822irc:// URI's do not work from a browser with gvfsxchatUndecidedConfirmed0001-add-new-mime-type-handling.patchpatch
933659evolution calendar does not check SSL certificatesevolution-data-serverUndecidedConfirmedcheck-ssl-certificates.patchpatch
933417Stack smashing while using a lot of connectionslibfcgiUndecidedNewpoll.patchpatch
932850add PAX refcount overflow protectionlinuxUndecidedConfirmedPAX reference count overflow protectionpatch
932225logrotate cron script fails for logs with a spacelogrotateUndecidedNewProposed replacement for /etc/cron.daily/logrotatelogrotate
932225logrotate cron script fails for logs with a spacelogrotateUndecidedNewlogrotatelogrotate
932166ganeti2 can not determine kvm versionganetiUndecidedConfirmedfix-qemu-1.0-compat.patchpatch
931976run in xpdfrc need quotation marks, but this is not documentedxpdfUndecidedConfirmedxpdf-fix-parsing3.patchpatch
931849Fonts in emacs look different than in gedit or gnome-terminalemacs23UndecidedNew0001-Add-dpi-font-scaling-to-Xft-driver.patchpatch
931679dm_map mod not loaded when booting with persistent=cryptsetuplive-initramfsUndecidedNewadded modprobe dm_mod (device mapper) to open LUKS files/partitionsdiff
931425Cannot specify a default bridge with xen xl stackxenWishlistTriagedBackport of my upstream patch submissionpatch
930916amavis start-stop script fails to stop amavisdamavisd-newHighConfirmedamavis-init-patch.diffdiff
930916amavis start-stop script fails to stop amavisdamavisd-newHighConfirmedamavisd-new_2.6.5-0ubuntu4.debdiffdebdiff
930786show mouse could use Ubuntu orange colourcompiz-plugins-extraUndecidedConfirmedubuntu-branding.patchpatch
930783mouse poll is jerky at the default setting of 40mscompiz-plugins-mainUndecidedConfirmedsmoother-mouse.patchpatch
929694gamepad has incorrect code. linuxMediumConfirmedlinux-gamepad.patchpatch
929415Wrong quoting in session script of gconfgconfUndecidedNewfix quotingpatch
929323The debian patches from lp:debian/pycryptopp don't apply to trunkpycryptoppUndecidedNewhttps://code.launchpad.net/~tahoe-lafs/+recipe/pycryptopp-dailytxt
929298jetty startup shows grep errorjettyUndecidedConfirmedpatch grep command in /etc/init.d/jettypatch
929108support reading PIN from file when using PKCS#11 devicesgnutls26UndecidedNewAdd back basic pinfile support.diff
929054AltGr key doesn't work properly in xfce4-terminal and gnome-terminal with Maori layout, and Hawaiian is not supportedconsole-setupUndecidedNewPatch adding Hawaiian layoutdiff
929054AltGr key doesn't work properly in xfce4-terminal and gnome-terminal with Maori layout, and Hawaiian is not supportedconsole-setupUndecidedNewThis adds the Hawaiian layout to alternative US layouts.diff
929054AltGr key doesn't work properly in xfce4-terminal and gnome-terminal with Maori layout, and Hawaiian is not supportedxfce4-terminalUndecidedNewPatch adding Hawaiian layoutdiff
929054AltGr key doesn't work properly in xfce4-terminal and gnome-terminal with Maori layout, and Hawaiian is not supportedxfce4-terminalUndecidedNewThis adds the Hawaiian layout to alternative US layouts.diff
9288202.37.91: **: soup_uri_set_path: assertion `path != NULL' failedmidoriUndecidedNew0001-soup-uri-revert-some-of-the-previously-added-return-.patchpatch
928596Flurries condition is marked as 'Unknown'indicator-weatherLowConfirmedfix_flurries.patchpatch
928432spice backend fails to build on i386 with -Werrorqemu-linaroMediumTriagedconfigure patchpatch
928182xendomains produces ugly output on shutdownxen-commonLowTriagedproposed.debdiffdebdiff
927850kernel module fails build with dkmspowervr-omap3UndecidedNewPatch to adapt the kernel modules to build with Linux 3.0+patch
927781PXELINUX implementation doesn't respect dhcp ConfigFile or PathPrefix valuesu-boot-linaroUndecidedIn Progressproposed RFC 5071 implementationpatch
927497Add bash completion script for recordmydesktoprecordmydesktopUndecidedNewBash autocompletion script for recordmydesktopautocp
926433indicator-weather leaves .pid file in /tmp and will not restartindicator-weatherUndecidedConfirmedpatchpatch
925162sitebar postinst script doesn't work with Upstartified mysql-serversitebarUndecidedNewpatch to Lucid sitebar.postinst scriptdiff
924676Make screen completion match the -S namebash-completionLowTriagedpatch to satisfy this feature requestpatch
924622[UEFI] GRUB 2 Blank Screen (no font)grub2UndecidedConfirmedPatch for Grub 2 1.99-21ubuntu2patch
924622[UEFI] GRUB 2 Blank Screen (no font)grub2UndecidedConfirmedubuntu_no_smooth_boot_on_efi.patchpatch
923900Enable iwlwifi drivers for compat-wireless v3.2 backportslinux-backports-modules-3.0.0UndecidedIn Progress0001-UBUNTU-Enable-iwlwifi-for-compat-wireless-3.2.patchpatch
923779cross-linker behaviour differs from native linkedbinutilsUndecidedConfirmed3.diffdiff
923779cross-linker behaviour differs from native linkedbinutilsUndecidedConfirmed4.diffdiff
923779cross-linker behaviour differs from native linkedbinutilsUndecidedConfirmedbinutils-2.deb.diffdiff
923161Hardcoded i686 architecture breaks x86_64 buildsluarocksUndecidedNewLet luarocks discover the architecture dynamically, since this is an all-arch package.patch
921078FATAL: kernel too old ← how old is too old?eglibcMediumTriagedqemu-linaro-921078.patchpatch
920852The library does not worklibpdl-netcdf-perlUndecidedConfirmedlibpdl-netcdf-perl_4.07-1build3.tar.gzgz
920840Recommend: build -dbg .debgtk3-engines-unicoUndecidedNew01_add_debug_package_to_build01_add_debug_package_to_build
920834ibus cannot show icon in panel without appindicatoribusUndecidedNew05_appindicator.patchpatch
920678Working backend for Epson V700 (GT-X900) and V200 (GT-F670)scanbuttondUndecidedNewscanbuttond_epson_vseries.patchpatch
920636Clearing up language in man page of ssh-keygenopensshUndecidedConfirmedPatch with suggested wording to make statement correctdiff
920474nova client requires NOVA_VERSION in environmentpython-novaclientMediumNewproposed patchdiff
918543vbox build fails with NameMapper.NotFound: cannot find 'mac' vm-builderMediumNewvmbuilder_vbox.patchpatch
918168cannot build sapgui .deb package in i386sapgui-packageUndecidedNewpatchpatch
918103Cairo-clock doesn't work well without compositingcairo-clockUndecidedNewUse XShape when compositing is unavailablepatch
915985usbhid-ups regression (APC BE525-RS)nutMediumConfirmedapc-hid-overflow.diffdiff
915719srptools init script fails with "/etc/init.d/srptools: line 59: where: command not found"srptoolsUndecidedNewfix for the errorpatch
915683Aldo segfaults when no filename is given for the 3. Read from file optionaldoUndecidedNewA patch that gracefully handles the no-filename-provided bug. Does not address filenames that don't exist.patch
915651Many fortunes point to dead URLsfortunes-ubuntu-serverUndecidedNewUpdate URLs to Ubuntu help sitepatch
915484s3cmd: FutureWarning (patch)s3cmdUndecidedNewCloudFront.py.diffdiff
914711Corrupt filename created when saving from XSane scan viewerxsaneUndecidedNewxsane-back-gtk.c.patchpatch
914479dh-make-perl cache is broken in oneiricdh-make-perlUndecidedIn Progresscache-fix-from-debian.patchpatch
914382Support oxygen gtk theme in abstractions/gnomeapparmorUndecidedIn Progressapparmor_oxygen_gtk.diffdiff
913874live-config script is broken in ubuntulive-configUndecidedNewFix config.sh inclusion/exclusion of config files.gz
913637--with-sub-version build option is always "-" (should be -revision)evolutionUndecidedNewFix_blank_sub_version.patchpatch
913413Catfish context menu item 'Jump to' does nothing in LubuntucatfishUndecidedNewenable-Jump-to-in-Lubuntu.diffdiff
913336grub-common recreates /etc/grub/grubenvgrub2UndecidedConfirmedgrubenv.diffdiff
913336grub-common recreates /etc/grub/grubenvgrub2UndecidedConfirmedzfs-no-grubenv.patchpatch
913336grub-common recreates /etc/grub/grubenvgrub2UndecidedConfirmedzfs-ubuntu-disable-recordfail.patchpatch
912945true/false in C bindings conflicts with C99's true/falseid3lib3.8.3UndecidedNewc99_guard_globals.h.diffdiff
912941Broadcom 4331 is not supportedb43-fwcutterUndecidedNewfix postinst script to support 4331patch
912695libpam_blue requires root, fails if non-privilegedlibpam-blueUndecidedNewImproved patch to bluescan.cpatch
912695libpam_blue requires root, fails if non-privilegedlibpam-blueUndecidedNewPatch bluescan.c to use hci_read_remote_namepatch
912524cairo-clock has a white triangle in the bottom right cornercairo-clockUndecidedConfirmedPatch to hide the resize gripdiff
911747[Feature] Add AuthorizedKeysCommand to OpenSSHopensshWishlistTriagedThe RedHat patch for OpenSSHpatch
911269evolution-exchange is ignoring already translated menu-items (Permissions..., Berechtigungen...)evolutionMediumTriagedevolution-exchange_3.2.1-2ubuntu2.debdiffdebdiff
911269evolution-exchange is ignoring already translated menu-items (Permissions..., Berechtigungen...)evolution-exchangeMediumTriagedevolution-exchange_3.2.1-2ubuntu2.debdiffdebdiff
911233index++ crashed with SIGSEGV, indexing an email encoded in base64swish++UndecidedConfirmedswish++-6.1.5.diffdiff
911070cairo.Error: input string not valid UTF-8 pybootchartguiUndecidedNewfilter-chars.diffdiff
911043race in lock checking?ubumirrorUndecidedNewpatchpatch
910924livecd: initrd: scripts/casper-helpers: fstype returns ext3 on luks containercasperMediumConfirmedcasper-helpers: use blkid instead of fstype (see bug description)diff
909919scripts/casper-bottom/41apt_cdrom is missing some sanity checking, can cause hang on bootcasperLowConfirmed41apt_cdrom_sanitycheck.patchpatch
909026fix non-ASCII filenames in WebDAV (kioslave http)kdelibsUndecidedNewfix for KDE 3diff
909016log file syntax broken due to interpretation of certain encoded chars in urlssquidguardUndecidedConfirmedHTParse.patchpatch
908926"Large Font" style option does not worklightdm-gtk-greeterLowConfirmedProposed patchpatch
908908uninitialized variable in wbinfo_group.pl causes false authentication resultssquidMediumNewpatching unitialized variable and pack function callpatch
908823Event time from Evolution calendar is off by 1 hour for Asia/YekaterinburglibicalHighIn ProgressPatch refreshed for 0.44-3diff
908765libjogl2-java version 2.0-rc3-7 failed to build on armv7 armhf, armellibjogl2-javaUndecidedConfirmedarmv7 FTBFS patchpatch
908618overlay scrollbars crash my programoverlay-scrollbarHighNewadd_lockadd_lock
908400Provided SQL script (i.e., create_tables.sql ) creates problemslibapache-mod-log-sqlUndecidedNewCorrectly-named table in this filesql
907899ebook-viewer does not have a .desktop filecalibreWishlistConfirmed.desktop file I use locallydesktop
907446Corrupt ttys, splash; Console colour dummy devicegrub-gfxpayload-listsUndecidedConfirmedBlacklist Intel 815 devices from GRUB GFX handoverpatch
907446Corrupt ttys, splash; Console colour dummy devicelinuxMediumConfirmedBlacklist Intel 815 devices from GRUB GFX handoverpatch
907152Error: unable to connect to '/var/run/libvirt/libvirt-sock', libvirtd may need to be started: No such file or directorynovaMediumTriagednova-compute.upstart.diffdiff
907152Error: unable to connect to '/var/run/libvirt/libvirt-sock', libvirtd may need to be started: No such file or directorynovaMediumTriagednova-compute.upstart.diff.v2v2
907152Error: unable to connect to '/var/run/libvirt/libvirt-sock', libvirtd may need to be started: No such file or directorynovaMediumTriagednova_2012.1~e4.diffdiff
907152Error: unable to connect to '/var/run/libvirt/libvirt-sock', libvirtd may need to be started: No such file or directorynovaMediumTriagednova_2012.1~e4.v2.diffdiff
907103gnome-shell unicode problemgnome-shellUndecidedConfirmeddateMenu.patchpatch
907033bzr smart server protocol dissectorwiresharkWishlistTriagedwireshark_1.6.5-2ubuntu1.debdiffdebdiff
906987syndaemon polls 5 times a second even though it is started with the -R XRecord extension optiongnome-settings-daemonUndecidedConfirmedlaunch syndaemon with an increased poll interval in gnome-settings-daemonpatch
906987syndaemon polls 5 times a second even though it is started with the -R XRecord extension optionxserver-xorg-input-synapticsMediumTriagedlaunch syndaemon with an increased poll interval in gnome-settings-daemonpatch
906825[11.10 - 12.04] lxpanel crashing randomly. High CPU-Load nothing is clickable correctly. Redraw failslxpanelUndecidedConfirmedFix infinite looppatch
906631git-instaweb overwrites gitweb_config.perlgitUndecidedNewon top of 1:1.7.7.3-1 for precisepatch
905607software raid component drives erroneously detectedos-proberUndecidedNewos-prober-mdadm.patchpatch
905552USB sound card not detectedmodule-init-toolsUndecidedNewClemens Ladisch's patch for the Yamaha MOX6 and MOX8patch
905147QPrinterDialog ignores default settings from CUPSqt4-x11UndecidedConfirmedmentioned patchpatch
904367Problems when ctrl_c_item is None (patch attached)glipperUndecidedConfirmedhistory.patchpatch
904231Typo in desktop filefgoUndecidedIn ProgressFix typo "Filght" in desktop filepatch
904205Desktop wall: Bindings for next/previous don't work.compiz-plugins-mainUndecidedConfirmedfixMovementsforNextPrevBindings.diffdiff
903853[Lenovo IdeaPad U300s, Conexant CX20590, Mic, Internal] Background noise or low volume (phase inversion)linuxMediumIn Progress0001-Fix-internal-mic-for-Lenovo-Ideapad-U300s.patchpatch
903526madplay crashed with SIGSEGV in _int_free()madplayMediumConfirmedmadplay-bug-workaround.patchpatch
903352an error occurred while I ran a web application with the play frameworkopenjdk-6UndecidedNewhs_err_pid5636.loglog
903098Please merge (sort of) couchdb 1.1.1-1 from Debian testingcouchdbUndecidedConfirmedcouchdb_1.1.1-1_to_1.1.1-1ubuntu1.debdiffdebdiff
903098Please merge (sort of) couchdb 1.1.1-1 from Debian testingcouchdbUndecidedConfirmedcouchdb_1.1.1-1_to_1.1.1-1ubuntu1_jderose.debdiffdebdiff
902628Clarify man page description of -f option (patch attached)util-linuxLowTriagedPatch for logger.1 man page to clarify -f optiontxt
902624process_command does not properly skip blank input linesdebconfUndecidedNewdebconf-process_command.diffdiff
902473acpid's script "lid.sh" should *source* lid.sh.pre and lid.sh.postacpidUndecidedNewsource lid.sh.{pre,post} from lid.sh (patch against acpid 1:2.0.10-1ubuntu2.3)diff
902468acpi-support/policy-funcs not checking for gnome-settings-daemonacpidUndecidedNewAlso check for "gnome-settings-daemon" in policy-funcs. (Patch against acpid 1:2.0.10-1ubuntu2.3)diff
902224The xbindkeysrc example ctrl+f to start xterm enabled by defaultxbindkeysUndecidedNewall examples are commentedxbindkeysrc
901627Cookie handling problems (w/ redmine)mongrelUndecidedNewmongrel-cookie.patchpatch
901410[Dell XPS L502X] Applying soft block to bluetooth hard blocks wlanlinuxMediumTriaged0001-dell-laptop-rfkill-blacklist-Dell-XPS-13z-15z.patchpatch
900770Typo in the german apt-get manpageaptLowIn Progresstypo-german-manpage.patchpatch
900620Possible Bug: php5-fpm does not listen on a socket by defaultphp5WishlistTriagedPHP-FPM - Use UNIX Sockets Instead of TCP Listenerpatch
900231Feature request: add support for defining overlappdfposterUndecidedNewThe patch to add overlap adjustmentpatch
899723[PATCH] Add partition resize function to BLKPGlinuxMediumTriaged0001-Add-partition-resize-function-to-BLKPG-ioctl.patchpatch
899717[PATCH] Loopback device partition cleanup on detachlinuxMediumTriaged0001-loop-cleanup-partitions-when-detaching-loop-device.patchpatch
899498Apple USB Ethernet fails when wake-on-lan is enabled (as happens by default)linuxMediumTriagedpossible patch for stable kernelpatch
899243[fsck.minix ] segfault while recovering directory with lots of filesutil-linuxMediumTriagedPatch that fixes the errorpatch
898851update-manager crashed with TypeError in function(): Must be number, not tupleaptdaemonHighTriagedDiagnostic helpdiff
898340mysql clients statically link libmysqlclient inmysql-5.5HighTriagedmysql-5.5-compile-clientprograms-dynamically.patchpatch
898077backtrace fails with recursive functions on 64bit (BZ #12432)eglibcUndecidedConfirmedbacktrace-bz12432-backport.diffdiff
898003usbip source is maintained in kernel tree nowusbipUndecidedConfirmedAnnotated abridged debdiff from current to Oneiricdebdiff
898003usbip source is maintained in kernel tree nowusbipUndecidedConfirmedDebdiff from Oneiric to Precisedebdiff
898003usbip source is maintained in kernel tree nowusbipUndecidedConfirmedSource package for Precisegz
898003usbip source is maintained in kernel tree nowusbipUndecidedConfirmedUpdated source package for Oneiric.gz
896978cueprint/cuetag: no "DATE" and "GENRE" tags are read/written from/to audiofilescuetoolsUndecidedNewcuetag.patchpatch
896692Last page of CHM incompletly rendered or missingchm2pdfUndecidedConfirmedFlush file before closing to avoi trouble on last page of documentdiff
896689: 'NoneType' object has no attribute 'version'aptHighConfirmedfix-upgradable.patchpatch
896584using ifmetric reports "NETLINK: Packet too small or truncated! 40!=16!=1004 "ifmetricUndecidedConfirmedDebian Patchpatch
894782Newline injection in error.logicecast2LowIn Progressicecast2_2.3.2-5ubuntu1.10.04.1.debdiffdebdiff
894782Newline injection in error.logicecast2LowIn Progressicecast2_2.3.2-5ubuntu1.10.10.1.debdiffdebdiff
894782Newline injection in error.logicecast2LowIn Progressicecast2_2.3.2-5ubuntu2.debdiffdebdiff
894739output formatting does not work decently for long user-selected passwords (>=13 chars)makepasswdUndecidedNewmakepasswd.patchpatch
894311ruby-rvm's maintainer scripts expect the admin group to existruby-rvmMediumConfirmedswitch from group admin to group sudo in debian/postinstpatch
894193Trouble if chm contains path with spaceschm2pdfUndecidedConfirmedFixing path with spaces patchdiff
893859gnome-shell doesn't support subpixel smoothinggnome-shellUndecidedConfirmedadd-subpixel-smoothing.patchpatch
893549using "find" in a symlinked folder does not return folder contentcatfishUndecidedConfirmedPatch which puts a / after the folder name if the find method is used.catfish_patch_symlinked-folder
892805Oneiric Server AMD64 installation CD does not detect HP Smart Array P600 diskslinuxMediumConfirmedadd-irqf-shared-to-cciss.patchpatch
892456conntact list emptykmessUndecidedNewkmess-contactlist.diffdiff
892410Wajig displays incorrect new and upgradeable package count wajigUndecidedNewwajig.counts.patchpatch
891970msp430-gdb segmentation fault with target remotegdb-msp430UndecidedConfirmedmsp430-gdb-7.3-fix-segfault.patchpatch
890928When trying to install libxkbfile1:i386 the pkg manager asks to remove too many important packages [Multi-arch]libxkbfileUndecidedConfirmedlibxkbfile_1.0.7-1ubuntu1.1.debdiffdebdiff
890882another broken link issuechm2pdfHighConfirmedchm2pdf_links_case_insensitive.diffdiff
890878no effort is done in chm2pdf to delete javascript chm2pdfHighConfirmeddelete javascript patchdiff
890877table background color removedchm2pdfHighConfirmedremoved background color patchdiff
890874Images not rendered in PDF due to upper/lower case spelling errorchm2pdfHighConfirmedImages case insensitive patchdiff
890873links not working in the PDF with upper/lower case spelling errorchm2pdfHighConfirmedlinks case insensitive patchdiff
890870multiple page problemchm2pdfCriticalConfirmedMultiple page problem patchdiff
889953bandwidth allocation problems with external USB audio devicelinuxMediumTriagedThomas Poussevin's patchpatch
889934manpage for 'killall' incorrectpsmiscLowConfirmedpsmisc_22.14.patchpatch
889553make.vim fails to recognize valid makeIdent with dashes during assignmentvimUndecidedNewpatch for vim 7.2 (ubuntu 10.04)patch
887446mlabel: renaming USB stick appends "nA" to namemtoolsMediumTriagedfix for bugpatch
887003package has incorrect default port for postgres9.1ruby-activerecord-2.3UndecidedNewChanged port numberstxt
886975Lenovo sound chip Conexant CX20549 Venice doesn't work correctly.linuxUndecidedConfirmedoneiric_lenovo.patchpatch
886667boot moves desktop iconsunityUndecidedIn Progressicon_container_size.patchpatch
886667boot moves desktop iconsunityUndecidedIn Progresstop_margin_workaround.patchpatch
886449[USB-Audio - USB Camera-B4.04.27.1, recording] Pulseaudio fails to detect cardpulseaudioUndecidedConfirmed0617-Add-default-4-channel-mic-array-profile.patchpatch
885989white screen on second monitor when using two xsessionsnautilusLowConfirmedif singleton have been initialized, the constructor don't construct again. Actually, It must construct again.patch
885947Location of "Left-handed" and "Right-handed" are switched, logicallygnome-control-centerLowConfirmedSwitches "Right-handed" and "Left-handed" to be more logical; not testedpatch
885836firefox-kde-support breaks right click > save image as...firefoxUndecidedTriagedfirefox_kde_savefile.patchpatch
885329eggdrop crash on i386eggdropUndecidedConfirmedeggdrop_1.6.19-1.2ubuntu4.debdiffdebdiff
885124kmenuedit does not correctly handle the OnlyShowIn fieldkde-workspaceMediumTriagedIf an entry has a present and empty OnlyShowIn field, we don't touch it unless the "only show in KDE" field is selected. Else, if we empty out an OnlyShowIn field, then we delete it from the .desktop file.patch
884639tips and trics section refers to "Region and Language" setting which does not existubuntu-docsLowIn Progressamended-bug884639.diffdiff
884639tips and trics section refers to "Region and Language" setting which does not existubuntu-docsLowIn Progressbug884639.diffdiff
884368unable to edit attributes in Inkscape XML Editor (Ubuntu overlay-scrollbar issues)overlay-scrollbarMediumConfirmed884368.patchpatch
883972gnome-terminal-prefs documentation is outdatedgnome-terminalLowTriaged883972-change-color-effect-helppatch
883972gnome-terminal-prefs documentation is outdatedgnome-terminalLowTriagedIn the help file for gnome-terminal changed effect menu to background and changed colour to colorpatch
883922Starting skype from Unity-Launcher does'nt workskypeUndecidedConfirmedPatched "/usr/share/app-install/desktop/skype.desktop"desktop
883361pcmanfm crashes with directory argumentpcmanfmUndecidedNewprevent gtk_window_present (NULL)patch
882874apt-cacher has poor childpid managementapt-cacherUndecidedNewPatch to fix the problemtxt
882874apt-cacher has poor childpid managementapt-cacherUndecidedNewUpdated patchtxt
882873No timeout when reading requests from clientsapt-cacherUndecidedNewPatch that mitigates the issuetxt
882670lb_chroot_dpkg doesn't check dpkg version before setting 'unsafe-io' optionlive-buildUndecidedNewubuntu-check-dpkg-version.patchpatch
882601Depends on fuse package which is not available in 11.10archivemountUndecidedConfirmedModify fuse dependency in debian/control.patch
882208Install error: Duplicate Definitionjed-extraUndecidedConfirmeddatutils.sl.patchpatch
882208Install error: Duplicate Definitionjed-extraUndecidedConfirmedemail.sl.patchpatch
882208Install error: Duplicate Definitionjed-extraUndecidedConfirmedlisting.sl.patchpatch
882110init script for stunnel4 is not lsb-compatiblestunnel4UndecidedConfirmedstunnel.init.in.patchpatch
881983libmemcached resets continuum with dead serverlibmemcachedUndecidedConfirmedAdd dead server retrybackoff-dead-reconnect
881983libmemcached resets continuum with dead serverlibmemcachedUndecidedConfirmedPatch to support server death on consistent distributions with 0.53diff
881887tcp filter not work with wlan0 ifaceiptrafUndecidedNewThis fix solve my problem but I don't know if add some other problem.patch
881787no application launcher (.desktop)haskell-leksahUndecidedConfirmeddesktop entry file for leksahdesktop
881771backfire-dkms uses SPIN_LOCK_UNLOCKED, removed in linux 3.0.xrt-testsUndecidedNew0001-Fix-deprecated-removed-spinlock-declaration.patchpatch
881660wired cannot be disconnected using Shell network appletgnome-shellMediumTriaged0001-network-set-callback-as-an-anonymous-function-for-di.patchpatch
881660wired cannot be disconnected using Shell network appletnetwork-managerMediumIn Progress0001-network-set-callback-as-an-anonymous-function-for-di.patchpatch
881218openjdk-7-jre depends on openjdk-6-jrejava-access-bridgeUndecidedConfirmedChange dependency from openjdk-6-jre to java6-runtime (fixes LP: #881218)diff
881135IBus indicator "missing icon"-icon shown when input method is enabledibusUndecidedConfirmed20-fix-ibus-icon-issue.patchpatch
880886Doesn't associated with mnemonic_widget property or accessibility related properties with some preference tool dialogs in GNOME Control Center applicationgnome-control-centerLowConfirmedThis is a startup point patch what can I begin changing for example with Power Manager UI file to Orca users hear importanter labelspatch
880872[oneiric] [precise] ubiquity shows pink areasubiquityUndecidedNewAdds support to check wether the [dark] colors are defined in the gtk theme or not and to use them or not consequently.patch
880685valgrind wrapper script crashes when LD_LIBRARY_PATH contains spacesvalgrindUndecidedNewFixdiff
879881crossfire-server segfault on startupcrossfireUndecidedIn ProgressPatch for server/account.c filepatch
8797642d-gnome.session hardwires metacity window managergnome-sessionUndecidedNewpatchpatch
878868syncpackage --no-lp picks up to many changelog entries in certain situationsubuntu-dev-toolsLowNewsyncpackage-878868.patchpatch
878836Unity Greeter - Use Unity Greeter to fulfil lock screen as well as login functionsgnome-screensaverLowTriaged0001-Make-gnome-screensaver-look-like-Unity-Greeter.patchpatch
878836Unity Greeter - Use Unity Greeter to fulfil lock screen as well as login functionslightdmHighTriaged0001-Make-gnome-screensaver-look-like-Unity-Greeter.patchpatch
878836Unity Greeter - Use Unity Greeter to fulfil lock screen as well as login functionsunity-greeterHighTriaged0001-Make-gnome-screensaver-look-like-Unity-Greeter.patchpatch
878262Latex toolbar does not disappear if editing a non-latex filegedit-latex-pluginUndecidedNewWindowactivatable.py Patch - Checks if the current file extension is in *latex_extensions*diff
878198Difficult to grab window borders in unity-2dmetacityUndecidedConfirmedAmbiance: larger window borders for Metacitypatch
877673Cross compilation fails due to pkg-configncursesUndecidedNewPatch to set PKG_CONFIG_LIBDIRpatch
877440[iOS 5] Unhandled Lockdown error (-15)libgpodUndecidedConfirmedlibimobiledevice_1.1.1-3ubuntu1.debdiffdebdiff
877440[iOS 5] Unhandled Lockdown error (-15)libplistUndecidedConfirmedlibimobiledevice_1.1.1-3ubuntu1.debdiffdebdiff
877440[iOS 5] Unhandled Lockdown error (-15)upowerUndecidedConfirmedlibimobiledevice_1.1.1-3ubuntu1.debdiffdebdiff
877318Nanny not working in Oneiric and PrecisenannyUndecidedConfirmedHelp Oneiric to find the right proccess to stoppatch
877131uk translationcatfishUndecidedNewuk_translation.diffdiff
877131uk translationcatfishUndecidedNewwithbug.diffdiff
876661libsqlite3-tcl has a broken pkgIndex.tclsqlite3UndecidedConfirmedproposed patchdiff
875961tigercron script fails on Linux 3.0tigerUndecidedConfirmedpartial fixpatch
875683software center tries to install adobe-flashplugin:i386 even if amd64 environmentapp-install-data-partnerUndecidedNewadobe-flashplugin_amd64.diffdiff
875435iBus indicator does not show on the panelibusMediumConfirmedibus-restart.debdiffdebdiff
874505Native Multistrap oneiric chroots have an error configuring base-filesbase-filesUndecidedConfirmedbase-files-6.5-postint.diffdiff
873784reload_passwd uses fgetpwent rather than getpwent, ignoring /etc/nsswitch.confaccountsserviceUndecidedConfirmedaccountsservice_0.6.14-1git1ubuntu1.2.debdiffdebdiff
873194Cannot build with DEBUG_UDPINTxinetdLowNewThis file is a patch to fix the reference for sin_portpatch
872991printer Hp 1320 needs Generic PCL 5e driver to work properlysystem-config-printerMediumConfirmedsystem-config-printer_1.3.6+20110831-0ubuntu9.1_1.3.6+20110831-0ubuntu9.2.debdiffdebdiff
872967gdecrypt won't start: picture format unknowngdecryptMediumConfirmedfix_icon.patchpatch
872967gdecrypt won't start: picture format unknowngdk-pixbufUndecidedConfirmedfix_icon.patchpatch
872967gdecrypt won't start: picture format unknownlibrsvgUndecidedConfirmedfix_icon.patchpatch
872894Unhandled INotify events break syncdaemon file watchingubuntuone-clientUndecidedConfirmednotif.patchpatch
872303no watch file in debian/watch for wine1.3-geckowine1.3-geckoUndecidedNewThe watch file, capable of fetching the new files (only if --no-symlink is used)watch
872055GtkNotbook scrolling tabs throug mouse doesn't work anymoregtk+3.0UndecidedConfirmedundo_no_scroll.patchpatch
871630New upstream releases (0.7.1 and 0.7.2) of SuperTuxKart available since July 2010, please packagesupertuxkartWishlistConfirmedSuperTuxKart-0.7.3_Irrlicht-1.7.3.diffdiff
870297Lightdm logins not being logged in wtmplightdmHighConfirmedupdate utmp on session start and use pam_lastlog to record wtmp/lastlogpatch
869829Text from lupin_setup is displayed at bootlupinMediumConfirmedframebuffer.patchpatch
869414wine1.2 watch file does not fetch newest wine1.2 (or even say 1.2.3 is the newest)wine1.2UndecidedNewWatch file that says 1.2.3 is newestwatch
869166Libpam-ccreds does not properly initiate libgcryptlibpam-ccredsUndecidedConfirmedFix.patch
868829Outdated 69-xserver-xorg-input-wacom.rulesudevUndecidedNewupdated_69-xserver-xorg-input-wacom.rules.patchpatch
868538 /etc/init.d/xinetd kills LXC container's xinetdxinetdLowConfirmedxinetd.patchpatch
868395Bug in Europe/Russia timezonestzdataUndecidedConfirmedPatch for tzdata2011jpatch
868318[needs-packaging] version 1.5.6pyparsingWishlistConfirmedpyparsing-1.5.2-to-1.5.6.debdiff.gzgz
868311Screenlets doesn't remember the correct workspace on restartscreenletsUndecidedConfirmed__init__.py.diffdiff
865529[PATCH] mapper and mdadm fail at bootcasperMediumNewAdd support for mapper and md devices so casper doesn't panic panic when the volumes are foundpatch
864779metacity grey background at session startupunity-2dHighConfirmedfix-grey-bg.patchpatch
864609libvte9 fails to record utmp/login entriesvteUndecidedConfirmedvte-pty-helper-path.patchpatch
864466break=foo boot option incompatible with gfxpayload=keepconsole-setupMediumTriagedupdated kbd patch (totextmode in /bin so it can be used reliably by friendly-recovery)diff
864466break=foo boot option incompatible with gfxpayload=keepkbdMediumTriagedupdated kbd patch (totextmode in /bin so it can be used reliably by friendly-recovery)diff
864352freepops fails to follow redirect containing an absolute pathfreepopsUndecidedNewPatchpatch
864193"Filter" input error message is not displayed due to japanese translation mistakecompizconfig-settings-managerUndecidedNewFix patchpatch
863834[regression] Suspend on lid close broken on Oneiricgnome-power-managerMediumConfirmedupower is-docked detection; ppa:alexei.colin/upower upower_0.9.13-1ac2patch
863834[regression] Suspend on lid close broken on OneiricupowerUndecidedConfirmedupower is-docked detection; ppa:alexei.colin/upower upower_0.9.13-1ac2patch
863314Panda hangs in suspendlinux-ti-omap4UndecidedNew0001-UBUNTU-Config-disable-SUSPEND-support.patchpatch
863101add ability to build cross compilergcc-snapshotLowIn ProgressDEPRECATED: review only: hardcode /usr/TRIPLET/include in patches/cross-include.diffdiff
863101add ability to build cross compilergcc-snapshotLowIn ProgressMERGED: apply cross patches for gcc-snapshot-TRIPLET toopatch
863101add ability to build cross compilergcc-snapshotLowIn ProgressMERGED: control.m4: handle gcc-snapshot-TRIPLETpatch
863101add ability to build cross compilergcc-snapshotLowIn ProgressMERGED: cross-(include|fixes) for trunkpatch
863101add ability to build cross compilergcc-snapshotLowIn ProgressMERGED: rename gcc-snapshot properly for cross buildspatch
863101add ability to build cross compilergcc-snapshotLowIn Progresscontrol.m4: alter B-Depends for cross: drop SOURCE_BUILD_DEP, add MPC_BUILD_DEP (gcc svn version)patch
863101add ability to build cross compilergcc-snapshotLowIn Progresscross build dependencies: added libmpc, dropped gcc-*-sourcepatch
863101add ability to build cross compilergcc-snapshotLowIn Progresshandle gcc-snapshot(-cross) in rulespatch
863101add ability to build cross compilergcc-snapshotLowIn Progresshandle gcc-snapshot-TRIPLET packagepatch
863101add ability to build cross compilergcc-snapshotLowIn Progressreview only: use /usr/TRIPLET/lib for librariesdiff
863101add ability to build cross compilergcc-snapshotLowIn Progressuse cross macros for dh_shlibdepsdiff
862992calibrate button does nothinggnome-color-managerMediumConfirmedInitialize_error_pointer.patchpatch
862416logcheck ignore and violation rules are not matching on alternate policy banksamavisd-newLowNewlogcheck ignore.d.server diffdiff
862416logcheck ignore and violation rules are not matching on alternate policy banksamavisd-newLowNewlogcheck violations.ignore.d diffdiff
862287[Lucid] Front, Surround, LFE, and Center volume meters are default muted with 00:1b.0 Audio device: Intel Corporation N10/ICH 7 Family High Definition Audio Controller (rev 01) sound cardalsa-utilsUndecidedNewA possible solution to resolve with this soundcard experienced problem and for example an Nvidia soundcard experienced problem my desktop machinepatch
862136Can't define network with IPv6 address in libvirt - fails to define addresslinuxMediumTriagedStart dummy bridge interface 'up' rather than 'down'patch
861656Kernel oops when nbd device is removed before it is unmountednovaHighConfirmeddebdiff solving the issuedebdiff
861498Memory corruption when using many arraysbcUndecidedNewFix for this bugpatch
861249backupninja does not support cloudfilesbackupninjaWishlistTriaged/usr/share/backupninja/duppatch
861132setenv ("NAME", NULL) corrupts environmenteglibcUndecidedNewProposed fixpatch
860938Spelling Error in Control File DescriptionrapidsvnLowTriagedControl File Patchcontrol
860600Media keys aren't working (Ubuntu 11.10, Pithos latest daily)gnome-settings-daemonLowConfirmedguayadeque_0.3.1~dfsg0-1ubuntu0.1.debdiffdebdiff
860600Media keys aren't working (Ubuntu 11.10, Pithos latest daily)gnome-settings-daemonLowConfirmedupstream revision 1660 fixing the bugpatch
860044Ubiquity panel is oversizedubiquityLowNew860044-ubiquity-panel.patchpatch
859754Ubiquity title and status text unreadable with Adwaita themeubiquityLowTriagedPatch for ubiquity/frontend/gtk_ui.py to fix color problems with themes other than Ambiance/Radiancediff
859652ffmpegthumbnailer is not compatible withe gnome3ffmpegthumbnailerWishlistTriagedffmpeg.thumbnailerthumbnailer
859367Spelling and Grammar Errors in Control File DescriptiongpredictUndecidedConfirmedControl File Patchcontrol
859244Hangs when parsing keymap from dumpkeyslogkeysUndecidedNewprevents endless loop if no U+#### founddiff
859108low image quality when grabbing with dvgrabdvgrabUndecidedNewdvgrab patch by Herman Robakpatch
858973RecordItNow doesn't stop record since Oneiric (patch available)recorditnowUndecidedConfirmedrecorditnowfix858973.diffdiff
858631Spelling Error in Control File DescriptionsauerbratenUndecidedNewControl File Patchcontrol
858553Spelling Error in Control File Descriptionri-liUndecidedConfirmedControl File Patchcontrol
857780Grammar and Formatting Error in Control FilegatosUndecidedNewControl File Patchcontrol
857598socksify fails to rundanteUndecidedConfirmedpatch to socksify for 64bitpatch
857598socksify fails to rundanteUndecidedConfirmedpatch to socksify for 64bit without "set -x"patch2
857299banshee window remain white on startup on armelbansheeHighTriagedbug-857299.patchpatch
856311apt-ftparchive CacheDB truncates SHA512 hashesaptHighIn Progressapt.ftparchive-cachedb-sha512.patchpatch
856277Lens button set narrow width which is needednuxUndecidedConfirmednux.diffdiff
856277Lens button set narrow width which is needednuxUndecidedConfirmedunity.diffdiff
856277Lens button set narrow width which is neededunityHighConfirmednux.diffdiff
856277Lens button set narrow width which is neededunityHighConfirmedunity.diffdiff
855758ECB layout hooks cause frames to be split twice on show-bufferecbUndecidedNew0001-Fix-a-layout-bug-that-causes-frames-to-be-split-twic.patchpatch
855661Some indicators are completely white when the dash is openunityUndecidedConfirmedpatch.diffdiff
855144Localizations are not shippedcolordUndecidedNewChange the control file to depend on dh-translationspatch
855144Localizations are not shippedcolordUndecidedNewChange the rules file to run dh_translations at build timepatch
855144Localizations are not shippedcolordUndecidedNewUse the policy.in file to extract translationspatch
854779change behavior on ubuntu with proxy aptvm-builderLowConfirmedproxy.patchpatch
854656ping options not in alphabetical order in man pageiputilsUndecidedNewping.diffdiff
852776Initial dvb-c scan file for Jyväskylä is incomplete.linuxtv-dvb-appsUndecidedNewOver 100 channels, so comment out what you don't want.Elisa-Jkl
852519Typos and missing entity in Kubuntu 11.10 documentationkubuntu-docsUndecidedNewBetter version of the patchdiff
852519Typos and missing entity in Kubuntu 11.10 documentationkubuntu-docsUndecidedNewpatch.diffdiff
852095upstream tarball differs from that of googlecode and pypipython-moxUndecidedConfirmeddiff between the two tarballspatch
851612Logging out from a FUS session does not reliably return to VT7lightdmHighTriagedlightdm_patch_for_oneiric.debdiffdebdiff
851612Logging out from a FUS session does not reliably return to VT7xorg-serverHighTriagedlightdm_patch_for_oneiric.debdiffdebdiff
849891Incomplete and error-filled dictionarymyspell-svUndecidedNewhunspell-sv-se_1.46-2_all.debdeb
849736apt-cache policy silently shows inaccurate information when any file in /etc/apt/sources.list.d is unreadableaptLowIn Progressapt-unreadable_sources.patchpatch
849736apt-cache policy silently shows inaccurate information when any file in /etc/apt/sources.list.d is unreadableaptLowIn Progressapt-unreadable_sources_notice.patchpatch
849349libgssapi2-heimdal init_auth() discards configured enctypesheimdalUndecidedNewPatch to lib/gssapi/krb5/init_sec_context.c5
846394Snowball not supported by flash-kernelflash-kernelUndecidedNewST-Ericsson Snowball support patchpatch
845194support --oneline option for git log completionzshUndecidedNewgit log completion config with support for --oneline optionpatch
842647[git] file blocks duplicated at the end of the fileecryptfs-utilsHighTriaged[PATCH] eCryptfs: Ensure i_size is set in ecryptfs_getattr()patch
842640FTBFS on yama-capable systemslibdevel-bt-perlHighIn Progressdebian-changes-0.05-1ubuntu105-1ubuntu1
842339Spelling Error in Control FileextcalcLowTriagedControl File Patchcontrol
841661smart reports "error: Unsupported scheme: ssh" if ssh method used in APT source listsmartMediumTriagedsmart-aptchannelsync-ssh.diffdiff
841475Modify rules.defs to use both GCC_TARGET in addition to DEB_TARGET_GNU_TYPE if both are specifiedgcc-4.5UndecidedNewImplementationpatch
841182rfc3442-classless-routes does not support gateway of 0.0.0.0isc-dhcpUndecidedNewfix for gateway of 0.0.0.0patch
840942set_size_request is ignored [update-manager details is one line]gtk+3.0MediumConfirmedfix_dialog_sizes.patchpatch
840709Formatting and Spelling Errors in Control fileconduitUndecidedNewControl File Patchcontrol
840467Bash-completion does not respect end of options argument (--)valgrindUndecidedNewMake arguments after -- complete as commandspatch
840093Spelling and Grammar Errors in Control FileennaUndecidedNewControl File Patchcontrol
839830cdrom/codename and suite no longer set in debconfiso-scanUndecidedConfirmedset codename and suite for selected isodiff
839735desktop-webmail: GMail URL failesdesktop-webmailUndecidedConfirmeddata_webmailers.patchpatch
839684desktop-webmail: Malformed recipe (%t)desktop-webmailUndecidedNewAllows parameters with or without 'mailto:'-prefix.patch
838720Crash on folder name with spacesiso-scanUndecidedConfirmediso-scan.postinst.diffdiff
838359lyrics fetching fail due to lyrics.wikia.com changesonataUndecidedConfirmedsonata.patchpatch
838200No network support on Beagle XMlinuxMediumConfirmedconfig.diffdiff
837789should install gsettings override with dhubuntu-artworkUndecidedConfirmedgsettings.override.patchpatch
837216Appindicator support in SonatasonataUndecidedNewAppindicator support in sonatapatch
836866bamfdaemon crashed with SIGSEGV in sn_xcb_display_new()startup-notificationUndecidedConfirmedfix_836866.patchpatch
836277open-vm-dkms doesn't detect vmxnet and vsock properly during installopen-vm-toolsMediumConfirmedopen-vm-dkms_conf.patchpatch
836250[Oneiric] [Regression] Intel Corporation Centrino Ultimate-N 6300 poor networking, packet loss and very slow Lenovo X201 and T500 laptopslinuxHighTriaged0001-iwlagn-finer-grained-HT-disable-oneiric.patchpatch
836250[Oneiric] [Regression] Intel Corporation Centrino Ultimate-N 6300 poor networking, packet loss and very slow Lenovo X201 and T500 laptopslinuxHighTriaged0001-iwlagn-finer-grained-HT-disable-precise.patchpatch
836250[Oneiric] [Regression] Intel Corporation Centrino Ultimate-N 6300 poor networking, packet loss and very slow Lenovo X201 and T500 laptopslinuxHighTriagedpatch to selectively enable/disable HT featurespatch
835817xrandr client truncates pixel clock freq. [Lucid]x11-xserver-utilsMediumTriagedPatch to fix truncating of pixel clock freq.patch
835614amispammer references dead blacklistsamispammerUndecidedConfirmedamispammer.diffdiff
834901Apparmor profile blocks geoip db accessbind9LowTriagedPatch to apparmor-profile to permit use of GeoIP databasespatch
834802Upconvert 'system-ready' startup sound to 5.1 surroundubuntu-soundsWishlistTriagedubuntu.flacflac
834369Spelling and Grammar Errors in Control filealien-arenaLowTriagedControl file patchcontrol
834204New Software Center icon unclear at normal sizesoftware-centerUndecidedIn ProgressSVG filesvg
834204New Software Center icon unclear at normal sizesoftware-centerUndecidedIn Progressnew iconstar
834204New Software Center icon unclear at normal sizesoftware-centerUndecidedIn Progresssoftwarecenter.zipzip
834199Spelling and Grammar Errors in Control filebiniax2LowTriagedControl file patchcontrol
834098Spelling and Grammar Errors in Control filebtanksLowTriagedControl file patchcontrol
833288/etc/init.d/cryptdisks does not have a working 'start' optioncryptsetupLowConfirmedPatch to include a working start option in /etc/init.d/cryptdiskscryptdisks-do_start-patch
833101perf uses less at the default pager, but the linux-tools packages have no dependency for itlinuxUndecidedIn Progressperf-less.patchpatch
833101perf uses less at the default pager, but the linux-tools packages have no dependency for itlinux-linaroUndecidedNewperf-less.patchpatch
832243On 32bit host arm-linux-gnueabi-objdump segfaultsarmel-cross-toolchain-baseUndecidedTriagedbinutils.deb.diffdiff
832243On 32bit host arm-linux-gnueabi-objdump segfaultsbinutilsUndecidedTriagedbinutils.deb.diffdiff
832059rounding error interrupts GPXViewergpxviewerUndecidedConfirmedTentative solution for ValueError exceptionpatch
831643kdump-tools fails to find dependency makedumpfile on armmakedumpfileUndecidedConfirmedAdds armel to the list of supported architectures.debdiff
831245slang-slirp version 1.9.8-1.1 failed to build in oneiricslang-slirpHighConfirmedslang-slirp-configure.diffdiff
831156unable to type passward for m-player codecs ie sundo in the terminal windowgnome-terminalUndecidedNewunable to install itsh
830724"Templates" misspelled in different places, as well as other English errors.alarm-clockUndecidedNewdescription in "Further information"ui
830438blurry indicator iconindicator-powerUndecidedConfirmedPatch to fix icon scaling problems.patch
829945purging all clamav packages doesn't remove /var/run/clamav directoryclamavMediumTriagedclamav-base.postrm.diffdiff
829649qpsmtp + clamscan plugin combo brokenqpsmtpdUndecidedNewclamav.diffdiff
829078Spelling and Grammar Errors in Control filemplayerUndecidedConfirmedSpelling corrections and suggested changescontrol
829078Spelling and Grammar Errors in Control filemplayerUndecidedConfirmedcontrolcontrol
828850software-properties-gtk crashed with DBusException in call_blocking(): com.ubuntu.SoftwareProperties.PermissionDeniedByPolicy: com.ubuntu.softwareproperties.applychangessoftware-propertiesMediumTriagedPatch that wraps an exception handler around each backend call. First try.diff
827279Several problems in cgclearlibcgroupMediumIn Progressproposed debdiff which appears to fix the problemsdebdiff
826702crontab cuts off file names at 100 characterscronUndecidedNewvixiecron-pathmax.patchpatch
825624patch: added dead_hook and dead_horn to latin keyboard layoutxkeyboard-configLowTriagedpatched /usr/share/X11/xkb/symbols/latinlatin
824408The Ubuntu add-on overrides user setting of middlemouse.contentLoadURLubufoxUndecidedConfirmedFix for resetting middlemouse.contentLoadURL settingpatch
824359Minor grammar mistake in u1sdtoolubuntuone-clientLowNewPatch produced by "bzr diff -p1 > spelling_p1.patch"patch
824359Minor grammar mistake in u1sdtoolubuntuone-clientLowNewPatch produced by "bzr diff > spelling.patch".patch
824144[EeePC 1001 PXD] suspend/resume kills bluetoothbluezMediumConfirmed06-Fix-disabled-after-resume.patchpatch
823956banshee --debug crashes with "Could not read add-in description"mono-addinsUndecidedConfirmedmono-addins-debug-crash.patchpatch
823624Bug openjdk-6 in redcar (Ubuntu 10.10)openjdk-6UndecidedNewlog errorlog
823150Please provide a python3 packagepyxdgUndecidedConfirmedpatchdebdiff
822432dmidecode does falsely use bit 7 when decoding the chassis-typedmidecodeUndecidedNew0001-Make-dmi_chassis_type-aware-of-the-lock-bit.patchpatch
821998Grid plugin: resize action description - "upper" vs. "top"compiz-plugins-mainUndecidedNewPatch to rename "Upper" to "Top"patch
821951sort -u erase some utf8 characterslangpack-localesHighTriagediso14651_t1.diffdiff
821950hybserv needlessly wakes up every 200 microsecondshybservUndecidedNewdebdiffdebdiff
821950hybserv needlessly wakes up every 200 microsecondshybservUndecidedNewdebdiff v2debdiff
818987nautilus-actions-config-tool crashed with signal 5 in g_option_context_parse()nautilus-actionsMediumConfirmednautilus-actions.diffdiff
817786No support for smooth frequency curve in pulseaudio-equalizerpulseaudioUndecidedNewPatch providing such functionalitydiff
816739kicad warps mousekicadUndecidedNewnatural_zooming.patchpatch
816325xzdiff does not preserve diff's return valuexz-utilsUndecidedNewpatch for fixing xzdiffpatch
815504glibc double free when using postgres dlzbind9LowConfirmed0001-Do-not-allow-for-a-double-free.patchpatch
814609Purging old entries failed with wrong localedenyhostsUndecidedNewDenyHosts.patchpatch
814164The init script does not handle the script-security parameter correctly when there are multiple configuration filesopenvpnLowTriagedReset the script_security variable to avoid reusing it for other VPN configurationspatch
814031RAW SOCKETS leak in ICMP monitoring programswine1.2UndecidedNewPatch for icmp.c fixing the raw sockets leakdiff
813886Save as EPS or PS incomplete with cairo >= 1.10inkscapeLowTriagedfix clipping in groupspatch
812988panel does not pick up preseeded locale/translationubiquityUndecidedConfirmed812988.patchpatch
812503grub-installer fails on machine with many disksgrub-installerUndecidedNewgrub-installer.manydisks.preseed.patchpatch
811634Package description is not user friendlyinkscapeLowTriagedChange long description to the one suggested by Phil Bulldebdiff
811580konquest resets player colours on startupkdegamesUndecidedNewThis is the patch for newgamedlg.cctxt
811580konquest resets player colours on startupkdegamesUndecidedNewpatch.txttxt
809221unable to mount ceph root at bootmountallUndecidedNewfix-ceph-root-mount-atboot.diffdiff
807349au-Brisbane in Mythbuntu 11.04 is incomplete.linuxtv-dvb-appsUndecidedNewAn edited version of /usr/share/dvb/dvb-t/au-Brisbane including all frequencies etc.au-Brisbane
806177Misspelling in init.darpwatchUndecidedConfirmedPatch to fix spellingpatch
806145Lacks a status action in the init scriptarpwatchUndecidedConfirmedPatch to add status to init scriptpatch
806024Pop up dialogues not visible in full screen mode (linux, gnome)inkscapeLowTriagedmychanges.patchpatch
805240Typo in krunner plugins descriptionplasma-runner-amarokUndecidedIn ProgressNew version of plasma-runner-amarokrunner.desktopdesktop
805240Typo in krunner plugins descriptionplasma-runner-amarokUndecidedIn ProgressPatch file, in case someone would rather have it that way.diff
804583Causes errors with AppIndicator menu selectionsblueproximityUndecidedConfirmedProvides appindicator support for blueproximitypatch
803492New upstream version 0.1.48jschWishlistNewubuntu_changes-v2.debdiff.gzgz
803279 Xine-ui hangs at exit if ACTID_QUIT is trigged via lircxine-uiUndecidedNewxine-ui_actidquit.patchpatch
802985[lucid] /var/lib/dpkg/tmp.ci/preinst: 399: arithmetic expression: expecting EOF: "3.0-0-generic"debootstrapHighTriagedPatch for /usr/share/debootstrap/gutsypatch
802985[lucid] /var/lib/dpkg/tmp.ci/preinst: 399: arithmetic expression: expecting EOF: "3.0-0-generic"debootstrapHighTriageddebootstrap.deb.diffdiff
802402convert to dh_python2image-store-proxyUndecidedConfirmeddh_python2.patchpatch
802274Security issue in kwalletcli_getpin(1): tty I/O now properly disables echoing input when asking for a passphrase is not fixedkwalletcliLowConfirmeddebdiff to fix the security-issue for kwalletcli 2.03 (natty)debdiff
802274Security issue in kwalletcli_getpin(1): tty I/O now properly disables echoing input when asking for a passphrase is not fixedkwalletcliLowConfirmedmodified patch to applie on 2.03patch
801952problem with ATI Catalyst Control Center (Administrative Mode) launcherfglrx-installerUndecidedConfirmedamdxdg-su.patchpatch
801415Perform Auto-Type is brokenkeepass2UndecidedConfirmedpatch against version 2.17 source zippatch
801055No translationsnautilus-wallpaperUndecidedConfirmedRussian translate for nautilus-wallpaperpo
801055No translationsnautilus-wallpaperUndecidedConfirmednautilus-wallpaper-de_DE.popo
800910Kernel Upgrade forces removal of grub-efi due to missing recommends entryaptUndecidedConfirmedAdds EFI bootloaders to the recommends clausepatch
800552function plotter fails silently if called without selectioninkscapeLowTriaged10370_10369.diffdiff
799965cross-compiler doesn't have /usr/include on the search pathgcc-4.6UndecidedConfirmedhrw2.diffdiff
799432Source package can't be found if already previous foundaptLowTriagedapt-two_sources.patchpatch
798358Incorrect parsing of OpenID team ACLmoinUndecidedNewmoin-1.9.2-teams-regex.patchpatch
798293uscan should support parsing s3 bucket listingsdevscriptsUndecidedNewuscan-s3-support.diffdiff
798197[PATCH] Can't see window requesting attention from a different workspacewindow-picker-appletUndecidedNewPatch to show windows requiring attention on all workspacespatch
797491overo lcd43 touchscreen does not worklinux-linaro-omapUndecidedConfirmed0001-OMAP-DRM-support-for-Samsung-LTE430WQ-F0C-panel.patchpatch
796750apache2 startup fails with missing log directoryapache2LowConfirmedapache2-initscript-missing-logdir.patchpatch
796006Samsung Galaxy S Android 2.3.4 tethering does not work any longerlinuxUndecidedConfirmednet_usb_cdc_ether_android_rndis_quirk.patchpatch
795932ICQ doesn't work since June 10, 2011telepathy-hazeHighConfirmedlibpurple's client key workaroundpatch
795445Incorrect current working directory in postuploadduploadUndecidedNewFix CWD handling.patch
795315unknown protocol speaking not SSL to HTTPS port on apache2 reload/restartapache2LowTriagedput-listen-80-last.patchpatch
795315unknown protocol speaking not SSL to HTTPS port on apache2 reload/restartapache2LowTriagedsuggested debdiffdebdiff
793643/usr/lib/cli/qt-dotnet-4.5/libqyoto.so points to nowherekdebindingsUndecidedNewqyotofix.patchpatch
792937iforce kernel module doesn't recognize my joysticklinuxMediumConfirmedpatchpatch
791833Dell ST2220T Monitor responds to touch only on warm boot from windowslinuxUndecidedIn Progress0001-HID-multitouch-fix-handling-of-buggy-reports-descrip.patchpatch
791833Dell ST2220T Monitor responds to touch only on warm boot from windowslinuxUndecidedIn ProgressDellST2220T.patchpatch
791133QGraphicsView based applications garbled rendering in kvm with cirrus video driverqt4-x11UndecidedConfirmedfix-24bpp.patchpatch
790835[Asus EeePC 1001PXD] Wireless hotkey does not disable bluetoothlinuxMediumTriaged0001-rfkill-toggle-all-radio-devices-on-KEY_RFKILL.patchpatch
790551do_status return valuesgearman-interfaceWishlistNewdo_status output patchpatch
789463no _SetEventHandlerObj() method in Skype classskype4pyUndecidedConfirmedpatch that fixes the bugdiff
788506german version: incomplete translation and shortcuts not workinggtodoUndecidedNewImproved translation. Includes previous fix for shortcut problem.diff
788506german version: incomplete translation and shortcuts not workinggtodoUndecidedNewPatch: Use Alt+i for Entry ("E_intrag") and Alt+n for View ("A_nsicht")diff
788279Cluster LVM Daemon clvm does not startlvm2UndecidedNewclvm-patch.txttxt
787736RebuildData structs are leaked in rebuild() / do_rebuild()appmenu-gtkMediumTriagedpatched against natty version appmenu-gtk_0.2.1-0ubuntu3fix-memory-leaks
787736RebuildData structs are leaked in rebuild() / do_rebuild()appmenu-gtkMediumTriagedsimplify rebuild schedulingpatch
787307ls --color can't be interrupted when processing large directorycoreutilsUndecidedNewpatch for the bugdiff
787204virt-manager does not comply with the Ubuntu units policyvirt-managerUndecidedNewvirt-manager.diffdiff
787125atd fails to mail output of commands (Open of jobfile failed)atUndecidedNewworkaround solution to "jobfile not found" problempatch
784203cryptroot hook does not handle quotes in fstabcryptsetupUndecidedTriagedcryptsetup-1.1.3_patch3_patch
783389HP LaserJet 1000/1005/1018/1020/P1005/P1006/... (on USB) stopped working in 11.04, worked in 10.04hannah-foo2zjsUndecidedConfirmeddebdiff to fix the problem in Nattydebdiff
782756[PATCH] USB Graphire4 pad buttons stop working after pen inputlinuxMediumTriagedgraphire.diffdiff
782614make configuring DNSSEC validation easierbind9LowConfirmed0001-Add-a-named.conf.keys-file-for-storing-various-keys.patchpatch
782614make configuring DNSSEC validation easierbind9LowConfirmed0002-Install-the-named.conf.keys-file.patchpatch
782614make configuring DNSSEC validation easierbind9LowConfirmed0003-Include-the-named.conf.keys-file.patchpatch
782614make configuring DNSSEC validation easierbind9LowConfirmed0004-dnssec-in-options.patchpatch
782614make configuring DNSSEC validation easierbind9LowConfirmed0005-Add-in-the-current-root-.-DNSSEC-key.patchpatch
782412'gdesklets' package out of dategdeskletsWishlistConfirmedgdesklets-core-0.36.3-.in-files.patchpatch
781737policykit cannot grant special priviledges from LDAP-identified administratorspolicykit-1UndecidedConfirmedPrevents rights revocation in polkitagent/polkitagenthelper-pam.cpatch
781737policykit cannot grant special priviledges from LDAP-identified administratorspolicykit-1UndecidedConfirmedThe corrected patch with the cancel button working...patch
781700/usr/bin/gxine.real: error while loading shared libraries: libmozjs.so: cannot open shared object file: No such file or directory gxineUndecidedConfirmedgxine.xulrunner.patchpatch
781556bluetooth discovery fails: no devices found during scanbluezMediumConfirmedfix-ralink-rt5390-bluetooth-with-bccmd-v2.patchpatch
781556bluetooth discovery fails: no devices found during scanbluezMediumConfirmedfix-ralink-rt5390-bluetooth-with-bccmd.patchpatch
781556bluetooth discovery fails: no devices found during scanlinuxMediumConfirmedfix-ralink-rt5390-bluetooth-with-bccmd-v2.patchpatch
781556bluetooth discovery fails: no devices found during scanlinuxMediumConfirmedfix-ralink-rt5390-bluetooth-with-bccmd.patchpatch
781409Date menu picks wrong date in Tasque + Remember the MilktasqueUndecidedConfirmedPatchpatch
781054Critically improved Dutch translation available upstreamxfce4-appfinderMediumTriagedxfce4-appfinder.xfce-4-8.nl.popo
781045Critically improved Dutch translation available upstreamlibxfcegui4WishlistTriagedlibxfcegui4.xfce-4-8.nl.popo
780469Does not show list of files for multiarch packagessynapticUndecidedConfirmedfix_780469.patchpatch
780028Please allow building without utouchunityWishlistConfirmedunity-3.8.12-no-utouch.patchpatch
779639gnome screensaver activation is hindered by unobscure routinegnome-screensaverMediumConfirmed19_fix_invalid_screensaver.patchpatch
779639gnome screensaver activation is hindered by unobscure routinegnome-screensaverMediumConfirmedgnome-screensaver-fix-fade-to-black-back-to-desktop-bug.patchpatch
778676Crash on Edit ProfilesabayonUndecidedConfirmedprotosession.py.patchpatch
778619Festival TTS starts 'paused' for blocks of textfestivalUndecidedConfirmedPotential patch requires testing on ubuntu 11.04 alsa-utilsdiff
777565gconfd saved_state file has executable tag setgconfLowTriagedsaved_state-permissions.patchpatch
777554coffeescript fails to find nodejs in pathcoffeescriptUndecidedConfirmedExecute script with 'node' and not 'nodejs'patch
777491use arbitrary kernel for kdumpkexec-toolsUndecidedNew/etc/init.d/kdump patchpatch
777311Installing In Xen Paravirtualized Guest Fails To Load xen-netfrontlinuxUndecidedConfirmedubuntu-1104-xen-domu-networking.patchpatch
776937Nautilus extension stopped workingrabbitvcsUndecidedConfirmedcheckerservice.patchpatch
776633grub-installer fails if root is on 27th diskgrub-installerUndecidedConfirmedpatch to handle /dev/sdaa etc.patch
776561Errors with insmod, modprobe, modinfobash-completionUndecidedNewmodule-init-tools.patchpatch
776531xen-3.3 can't install on natty; gcc 4.5 problemsxen-3.3UndecidedNewXen Source revisions 20975, 21005, 21009, 22765diff
775785out of free space on /tmp causes apparmor loosing protection on reloadapparmorMediumTriagedno-tmp.patchpatch
775124Ubiquity should have a command line option to override the free space checkubiquityMediumTriagedubiquity-diskspace-needed.patchpatch
774740Huge memory leak in metacitymetacityMediumIn ProgressBug #774740.patchpatch
773564compiz occasionally hangs with 100% cpu usage (inotify plugin infinite loop)compizUndecidedConfirmedinotify runaway looppatch
773496libesd reset connection after short timeoutesoundUndecidedNewthis patch increses timeouts up to 300mspatch
772121typo in pam_tally manpagepamLowConfirmedpam_tally.patchpatch
771875Compiz Screenshot renders blue overlay on screenshotscompizUndecidedConfirmedpatch-workaround. Simply stops blue rectangle from being drawn.patch
771445CVE-2010-4655linux-lts-backport-maverickUndecidedNewhardy.patch2010-4655
769959accumulate property is undocumentedginnWishlistTriagedginn_0.2.4-0ubuntu2.debdiffdebdiff
769866tab completion no longer escapes filenames and completes dirnames incorrectly (space instead of slash)acroreadUndecidedConfirmedacroread_tab.patchpatch
769594gsettings-desktop-schemas 3.0.0-0ubuntu1 fails to create thumbnailers schema directory /usr/share/thumbnailers and necessary files withingsettings-desktop-schemasUndecidedNewcontents of /usr/share/thumbnailersgz
769594gsettings-desktop-schemas 3.0.0-0ubuntu1 fails to create thumbnailers schema directory /usr/share/thumbnailers and necessary files withingsettings-desktop-schemasUndecidedNewusr-share-thumbnailers-from-Fedora.tar.gzgz
768591ksh93: segmentation fault with printfkshUndecidedTriaged768591.patchpatch
767342Enable customized oem-config languages displayedubiquityUndecidedNewoem-config-customize-languages.diffdiff
767012ocsinventory-agent sends a invalid report to the serverocsinventory-agentUndecidedConfirmednon-utf-8.patchpatch
766195[patch] Implement live-boot compatibilityubiquityUndecidedNewlive-boot.diffdiff
765735mountall should cause fsck to show progress on text consolemountallMediumTriagedmountall.patchpatch
764321Please add launcher quicklist for bansheebansheeMediumIn ProgressThe .desktop files for Banshee and screenshot for the quicklists in Bulgarian and Eniglishgz
763823Add Luxembourgish hunspellhunspellUndecidedNewhunspell-lb-ludeb
763590typo in de.po from cpufreq-set (cpufrequtils)cpufrequtilsUndecidedNewde.po.20110417145858.patchpatch
763510Evolution freezes while browsing Google address bookevolutionMediumNewgdk-pixbuf-2.23.3 patchpatch
763457pyopencl falsely depends on nvidia-currentpyopenclHighConfirmedA two line patch to the control file specifying the ati opencl runtime and dev packages as alternatives to the nvidia cards. Prevents dependency hell for those of us with ATI cards.patch
763182misspelling in package summarylibpam-blueLowTriagedlibpam-blue_0.9.0-3ubuntu1.debdiffdebdiff
762680[panel] Application name should use metacity’s theme preferencesunity-2dUndecidedConfirmedunity-2d-title-color.patchpatch
762512getaddrinfo() should disregard link-local IPv6 addresses for AI_ADDRCONFIG purposeseglibcUndecidedNewgai-aiaddrconfig-ignore-link-locals.patchpatch
759545user prompted to update unmodified grub configuration during Ubuntu server upgradegrub2MediumTriagedDebdiff, adding maverick's md5sumdiff
758854Humanity does not support document type distinction by colorhumanity-icon-themeLowTriagedSample spreadsheet icon using LibO palettesvg
758854Humanity does not support document type distinction by colorhumanity-icon-themeLowTriagedSample text document icon using LibO palettesvg
758804Add support for ST-Ericsson CG2900 Bluetooth chipbluezUndecidedNewsnowball.patchpatch
756997wajig doesn't complete all sub-commandszshUndecidedNew_wajig.patchpatch
756894mount.ocfs2: join errors when node with kernel >= 2.6.37 joins with nodes with kernels < 2.6.37linuxMediumConfirmedPatch submitted by oracle to upstream 2.6.39gz
755151Graph in UI for Invada Compressor LV2 plugin does not match parametersinvada-studio-plugins-lv2UndecidedConfirmed0001-Fixed-wrong-graph-in-compressor-GUI.patchpatch
754647Having 10000+ tables on a single database crashes phpmyadminphpmyadminUndecidedTriagedFixes the pagination issues on navigation.phppatch
754414showttf.c: "Vender URL" should be "Vendor URL"fontforge-extrasLowTriagedshowttf.c.diffdiff
751901mayflash super joy box 5 pro can only use 1 gamepadlinuxMediumTriagedsuperjoy_box_5.patchpatch
751374Dash won't open files anymoreunityUndecidedConfirmedThe debdiff between exo-0.6.0-1 and exo-0.6.0-2diff
751106default keyboard from file [proposed patch]gfxboot-theme-ubuntuUndecidedNewkeyb.patchpatch
750585[FFe] support for making linux-libc-dev coinstallable under multiarchbash-completionMediumTriagedUBUNTU: [Config] Make linux-libc-dev coinstallable under multiarchpatch
750585[FFe] support for making linux-libc-dev coinstallable under multiarchbash-completionMediumTriagedklibc-1.5.20-multiarch-libc-dev.patchpatch
750585[FFe] support for making linux-libc-dev coinstallable under multiarchbash-completionMediumTriagedlinux-libc-dev-multiarch.patchpatch
750585[FFe] support for making linux-libc-dev coinstallable under multiarchbash-completionMediumTriagednewlib patch for multiarched linux-libc-devpatch
750108CROSS: set ac_cv_func_malloc_0_nonnull=yeslvm2UndecidedNewcross-build.diffdiff
747589Udev rules in libticables2-2 require updatinglibticablesUndecidedConfirmednew-devices-and-fixed-sysfs-warning.patchpatch
747517missing HTTP proxy supportrtmpdumpLowTriagedpatch by Daniel Burrpatch
746262mkdosfs rounds reserved sectors to cluster sizedosfstoolsUndecidedConfirmedComment out line 1061 of mkdosfsdiff
745881rtai version 3.8.1-4 failed to build on armelrtaiLowTriagedrtai-first-fix.patchpatch
745704gnome-do jira plugin does not maintain configurationgnome-do-pluginsUndecidedConfirmedPatch from gnome-do bug #354540diff
745112[arrandale] desktop is messed up with external monitors (x86_64)linuxHighTriaged2012-02-09-intel-dp-oneiric.diffdiff
745039Compilation error with gil (libboost1.40-dev) and g++-4.4boost1.40UndecidedNewgil-gcc-4.4.patchpatch
744905CouchDB should migrate automatically between minor/bugfix versionscouchdbUndecidedNewcouchdb-diskversion.patchpatch
744655a11y: "Deauthorize" and "Cancel" without acceleratorssoftware-centerUndecidedNewfix Deauthorize and other strings for a11ypatch
744264schroot can't handle unionfsschrootUndecidedConfirmedQuickfixdiff
743956Incorrect icon dimension of '22x22/sensors-applet-gpu.png'hicolor-icon-themeUndecidedNewGPU sensor icon, corrected to 22x22 pixelspng
743268gpg-agent not launched correctly in Xsesson scriptsgnupg2UndecidedConfirmedThis is the patch. It changes the script from running gpg-agent to running gpg-connect-agent.patch
741433Adding tests and :native to libdpkg-perl architecture qualifier parsingdpkgWishlistTriageddpkg-1.16.0~ubuntu5-archqualifiernative.patchpatch
741081Add 'Open a new terminal window' to unity launcher quicklistgnome-terminalWishlistConfirmedDebdiff to fix bugdebdiff
740213Ginn should subscribe only to gestures requestedginnLowTriagedDetermines which gestures are used and selectively subscribes them.patch
740178Update the INSTALL file.unityLowIn Progressunity_3.8.8-0ubuntu3.debdiffdebdiff
739495include in .ssh/configopensshWishlistConfirmedssh2.diffdiff
738806On Acer Aspire One AOD521 not work battery indicator applet.gnome-settings-daemonUndecidedNewao521-acpi.patch.gzgz
737838No way to change Tasque Preferences without a systray icontasqueUndecidedConfirmedappindicator.diffdiff
737838No way to change Tasque Preferences without a systray icontasqueUndecidedConfirmedunity_deps.patchpatch
737838No way to change Tasque Preferences without a systray icontasqueUndecidedConfirmedunity_indicator.patchpatch
737743ctrl-w should close network-settingsindicator-networkLowTriagedindicator-network_0.3.8-0ubuntu7.debdiffdebdiff
737002mkfs.hfsplus does not create UUIDhfsprogsUndecidedNewhfsplus-tools-332.14-fix-uuid.patchpatch
736521two segfaults in ruby inotify extension librarylibinotify-rubyUndecidedNewPatch on libinotify-ruby-0.0.2 deb source filesdiff
736491Panel Titlebar double click is emitted for any mouse buttonunity-2dUndecidedIn ProgressAdds a doubleleftclick signal for PanelTitlebarGrabAreadiff
736326typo in repetition subwindowstxt2regexUndecidedIn Progressbug-736326.diffdiff
736171168c:002a ath: Failed to stop TX DMA in 100 msec after killing last framelinuxMediumConfirmedath9k-Fix-race-in-starting-stopping-DMApatch
735675bzdiff does not pass -I option to diffbzip2UndecidedNewPatch for bzdiff to correct the issues described.patch
734530[wishlist] rssh git support (with patch)rsshWishlistConfirmedrssh git patch (vanilla 2.3.2)patch
733915Feature request: add number of unread messages in the Unity Launcher entry of Pidginpidgin-libnotifyWishlistConfirmed733915.debdiffdebdiff
733915Feature request: add number of unread messages in the Unity Launcher entry of Pidginpidgin-libnotifyWishlistConfirmed733915_2.debdiffdebdiff
733915Feature request: add number of unread messages in the Unity Launcher entry of Pidginpidgin-libnotifyWishlistConfirmed733915_3.debdiffdebdiff
733888wget ignores subjectAltNameswgetMediumTriagedwget-1.12-subjectAltNames-natty.debdiffdebdiff
733888wget ignores subjectAltNameswgetMediumTriagedwget-1.12-subjectAltNames.debdiffdebdiff
733563Can't change font for keyboard layout indicatorxfce4-xkb-pluginWishlistTriagedfont_selection.patchpatch
733507cpufreqd assert failure: *** glibc detected *** /usr/sbin/cpufreqd: free(): invalid pointer: 0x09067b10 ***cpufreqdMediumConfirmedA fix for this bug.patch
730972IdeaPad U160 Broadcom wifi not connectinglinuxMediumConfirmedPatch for Broadcom BCM4313 driver for kernel > 2.6.36patch
730698musb config'd out on 2.6.38-1000 kernellinux-linaro-omapUndecidedIn ProgressConfig changes for the 11.11 kernel.patch
730481Apps place indexes stopwordsunity-lens-applicationsUndecidedTriagedPatch adding stopword filtering, but it doesn't work too welldiff
730481Apps place indexes stopwordsunity-place-applicationsLowTriagedPatch adding stopword filtering, but it doesn't work too welldiff
730235crash when pressing enter on the last data column in View Data windowpgadmin3UndecidedNewfixing processing of 'enter' in the grid event handlerpatch
730228Provide insmod.staticmodule-init-toolsUndecidedNewmodule-init-tools (3.12-1ubuntu4)debdiff
730023Mountall doesn't swapon with 'ignore'-d swap in fstabmountallMediumTriagedPatch + example fstabgz
729903Xrandr, Handle RRScreenChangeNotify in src/screen.cppcompizLowConfirmed110_handle_xrandr_screen_change_notify.patchpatch
729499patch to restore transparency in system tray icongstmLowTriagedpatches gstm to use GtkStatusIcon rather then EggTrayIcon to provide a system tray icon.01-eggtrayicon-to-gtkstatusicon
728161Laptop subwoofer is not functional on ASUS G73JHlinuxMediumTriaged0001-ALSA-HDA-Fix-subwoofer-for-Asus-G73Jh.patchpatch
728015unity-window-decorator cmake install doesn't use DESTDIRcompiz-fusion-plugins-mainUndecidedNew001_opensuse_cmake_unity_decorator_install_fix.patchpatch
727232lernid crashed with ImportError in /usr/lib/pymodules/python2.7/desktopcouch/records/server.py: No module named application.serverdesktopcouchUndecidedConfirmedsame debdiff formated with debdiff rather than with bzrdebdiff
726635udev should not create a persistency-rule for virtualbox virtio network cardudevUndecidedConfirmedadd VirtualBox MAC-prefix to be ignored in /usr/lib/udev/rules.d/75-persistent-net-generator.rulespatch
726283umount segfaults with inconsistent entry in /etc/fstabutil-linuxUndecidedConfirmedmount-segfault-stopper.patchpatch
725566A fix and an enchancement for the applet-coherencecoherenceUndecidedNewthe sources debdiff between coherence_0.6.6.2-5.dsc coherence_0.6.6.2-6.dscdiff
725556Security problems (unacceptable behaviour) in sharing content via FSStore backendcoherenceLowTriagedthe sources debdiff between coherence_0.6.6.2-5.dsc coherence_0.6.6.2-6.dscdiff
725367primes returns compositesbsdgamesUndecidedNew725367d.diffdiff
725367primes returns compositesbsdgamesUndecidedNewSolution bdiff
724517isql segfaults in batch modeunixodbcMediumConfirmedPatch to remove errant variable declarationsdiff
72241160-persistent-input.rules does not create a symlink for interface #0 (with multi-interface USB devices)udevUndecidedNewdebdiff of the fixpatch
721982Corrupt display for history search in vi-mode, 256-color promptbashUndecidedConfirmeddynamic-msg_buf.diffdiff
721303Text of the buttons change, resizes buttonsnetwork-manager-appletMediumTriagedlp721303_no_ellipsis_on_buttons.patchpatch
720909FTBFS in nattyxen-3.3UndecidedConfirmedxen.debdiffdebdiff
720071munin-node amavis spam statsmuninLowTriagedaltered grep for "probably" and "surely spam"patch
717975prevu can't backport 3.0 (quilt) format packages from current directoryprevuUndecidedNewhackish fixpatch
715224emit "child-visible", "child-not-visible" signals when a GtkWidget is/isn't visiblegtk+2.0WishlistConfirmedthis patch contains doc integration as welldiff
714011remmina crashes when trying to export a rdp connection to windows .rdp fileremminaUndecidedConfirmedchanges.diffdiff
713473(lib)blkid looks in the wrong locations for TuxOnIce's swap signatureutil-linuxUndecidedTriagedDebdiff against natty's util-linuxpatch
713473(lib)blkid looks in the wrong locations for TuxOnIce's swap signatureutil-linuxUndecidedTriagedUpstream patchpatch
712892mount (silently) ignores options for bind mountsutil-linuxUndecidedTriagedro-retry.patchpatch
712614getty can't execute a login program with argumentsutil-linuxWishlistConfirmedubuntu-deb-src-util-linux-2.7.12_getty_login_args.diffdiff
712075[drm:drm_edid_block_valid] *ERROR* EDID checksum is invalidlinuxHighIn Progressdrm-Never-change-the-connector-status-to-unknown-whilst-polling.patchpatch
711304Create icon-theme.cache file to support mmap()ed icon loadingunityWishlistTriagedpatchdiff
709348some kernel config missing for wifi with IGEPv2 board (libertas driver finds no mmc interface)linux-linaro-omapUndecidedConfirmedThis is the patch I got from ISEE.patch
708712Wireless Card RTL819Xe on a Samsung N150 netbooklinuxMediumConfirmedIncrease time-outs for CPU init and firmware uploadpatch
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportclementineUndecidedTriageddebdiff that fixes the FTBFS for armdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportclementineUndecidedTriagedegl_qglcontext_stubs.diffdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportclementineUndecidedTriagedphonon-backend-gstreamer_4.7.0really4.5.0-0ubuntu2.1.debdiffdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportclementineUndecidedTriagedpyside_1.0.1-1ubuntu0.1.debdiffdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportclementineUndecidedTriagedqt-gles-arm.debdiffdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportqwtplot3dHighConfirmeddebdiff that fixes the FTBFS for armdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportqwtplot3dHighConfirmedegl_qglcontext_stubs.diffdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportqwtplot3dHighConfirmedphonon-backend-gstreamer_4.7.0really4.5.0-0ubuntu2.1.debdiffdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportqwtplot3dHighConfirmedpyside_1.0.1-1ubuntu0.1.debdiffdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportqwtplot3dHighConfirmedqt-gles-arm.debdiffdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportsofa-frameworkUndecidedNewdebdiff that fixes the FTBFS for armdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportsofa-frameworkUndecidedNewegl_qglcontext_stubs.diffdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportsofa-frameworkUndecidedNewphonon-backend-gstreamer_4.7.0really4.5.0-0ubuntu2.1.debdiffdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportsofa-frameworkUndecidedNewpyside_1.0.1-1ubuntu0.1.debdiffdebdiff
707794libqt4-opengl on armel should be compiled with OpenGL ES 2.x supportsofa-frameworkUndecidedNewqt-gles-arm.debdiffdebdiff
707592cupsd assert failure: cupsd: ../avahi-common/dbus-watch-glue.c:205: timeout_data_ref: Assertion `t->ref >= 1' failed.cupsMediumConfirmedcups-avahi-connecting.patchpatch
706918compiz crashed with SIGSEGV in RegexExp::evaluate()compizMediumConfirmedsrc patchpatch
706703build fails with very recent gcc 4.6: unused-but-set-variable errorbamfWishlistConfirmedpatchpatch
705925English interface whan using ru_UA localeabiwordLowTriaged/usr/share/abiword-2.8/profile-ru-UA
705925English interface whan using ru_UA localeabiwordLowTriaged/usr/share/abiword-2.8/stringsstrings
705925English interface whan using ru_UA localeabiwordLowTriaged/usr/share/abiword-2.8/templatesawt-ru_UA
705854caller station id (remotenumber fro pppd) rp-pppoeUndecidedNewAdd 'remotenumber' option to pppd command line for radius server attribute Caller-Station-IDpatch
705352Typos in config/configgreylistdUndecidedConfirmedgreylistd_0.8.7+nmu2ubuntu1.debdiffdebdiff
705178pam_namespaces and --make-shared vs mountallmountallUndecidedConfirmedpatchpatch
705112the menubar with appmenu-gtk is 1px tallgtk+2.0LowTriagedRe-re-try of the fixed patch using map/unmappatch
705112the menubar with appmenu-gtk is 1px tallgtk+2.0LowTriagedRe-try of the fixed patch using map/unmappatch
705112the menubar with appmenu-gtk is 1px tallgtk+2.0LowTriagedfixes the typopatch
705112the menubar with appmenu-gtk is 1px tallgtk+2.0LowTriagedupdated patchpatch
705112the menubar with appmenu-gtk is 1px tallgtk+2.0LowTriagedupdated patch of the updated patch :)patch
704665Please update 0001-trace-add-trace-events-for-open-exec-an.patchureadaheadUndecidedNew0001-ureadahead-2.6.39.patchpatch
704665Please update 0001-trace-add-trace-events-for-open-exec-an.patchureadaheadUndecidedNew0001-ureadahead-linux-3.2.patchpatch
704250missing dependency on correct input systemlanguage-support-input-thUndecidedConfirmedTested debdiff correcting package dependeciesdiff
704245caller station id (remotenumber) for pppdpptpdWishlistTriagedLaunch pppd with remotenumber command line, providing IP-address of calling station for radius serverpatch
704105Resize grip always appears in bottom right of GTK+2.0 windowsgtk2-engines-oxygenUndecidedConfirmedproposed change to 044_grips.patchpatch
702999oprofile failure on panda (omap4)linux-ti-omap4UndecidedConfirmed0001-arm-pmu-support-pmu-perf-on-OMAP4.patchpatch
702057[dash] Single instance applications are not focused/raised when clicked onunity-2dUndecidedConfirmedunity-2d-visibility.patchpatch
701549Bad slice indices / missing function in numpy.numarray.functionspython-numpyUndecidedNewQuilt patch which resolves described bugspatch
700720oggenc ignores --ignorelength switch, unable to process Large Wav filesvorbis-toolsLowConfirmedvorbis-tools.ignorelength.diffdiff
698007lirc init script can create circular symlinkslircMediumTriagedPatch compatible with patch in bug 697999patch
698007lirc init script can create circular symlinkslircMediumTriagedlirc init script patch to test that OLD_SOCKET ${OLD_SOCKET}1 aren't used by either device before deleting it.patch
698007lirc init script can create circular symlinkslircMediumTriagedpatch that merges the patches from both bugspatch
697999lirc init script seems to load things backwardslircMediumTriagedPatch to change order in which transmitter and remote are loadedpatch
697623Wallpaper plugin broken in Natty (11.04 alpha)compizLowConfirmedwallpaper.cppcpp
697623Wallpaper plugin broken in Natty (11.04 alpha)compizLowConfirmedwallpaper.hh
696990update for gcc-4.6 hardening patchesgcc-snapshotHighIn Progressgcc-4.6_4.6-20101220-1ubuntu0.1.debdiffdebdiff
696706`unison -ui graphic' does not show password dialog unisonUndecidedConfirmedpatch.txttxt
696538v4l vbi devices does not appear in /dev/v4l/by-idudevUndecidedNewpatch for the problempatch
696294[PATCH; python-imaging-sane] Py_*_ALLOW_THREADS for sane_get_devices and sane_open callspython-imagingUndecidedNewPatchpatch
696213xscreensaver-data-extra is missing screensaversxscreensaverUndecidedConfirmedpatch for control filepatch
695069gnome-doc-tool crashes when converting .page filesgnome-doc-utilsLowNewA patch against the current version in Natty, fixing this issuediff
695069gnome-doc-tool crashes when converting .page filesgnome-doc-utilsLowNewAn updated patch, better handing spaces in filenamesdiff
694463No possibility to use transparently mode in proxsmtpproxsmtpUndecidedNewproxsmtp-1.8-transparent.patchpatch
694351Installer gives unclear tickboxmsttcorefontsUndecidedNewA diff which changes the stringdiff
692922[10.04] Disappearing icons for Java appcompiz-fusion-plugins-mainUndecidedIn Progress20_javataskbar.patchpatch
692922[10.04] Disappearing icons for Java appcompiz-fusion-plugins-mainUndecidedIn Progresscompiz-fusion-plugins-main_0.8.4-0ubuntu3_javataskbar.debdiffdebdiff
692355fsck doesn't update system info on loginupdate-notifierMediumTriagedmotd-fsck.patchpatch
691050Daily cron job doesn't report failuresaptMediumConfirmedapt.cron.daily.patchpatch
690927Sync tpb 0.6.4-6 (universe) from Debian unstable (main)tpbWishlistIn Progressbeda-ubuntu-debian.diffdiff
690927Sync tpb 0.6.4-6 (universe) from Debian unstable (main)tpbWishlistIn Progressdebdiff debian-ubuntudebdiff
690927Sync tpb 0.6.4-6 (universe) from Debian unstable (main)tpbWishlistIn Progresstpb-0.6.4-6ubuntu1.diffdiff
690927Sync tpb 0.6.4-6 (universe) from Debian unstable (main)tpbWishlistIn Progressubuntu-debian.diffdiff
690370Strange out of memory on pandaboardlinux-ti-omap4MediumTriagedusbnet_oom_3.0-rc1.patchpatch
689915pulseaudio aborts with assertion decoded == a2dp->frame_length in function a2dp_process_push()pulseaudioUndecidedNew1001-src-modules-bluetooth-module-bluetooth-device-fix-incorrect-assert-test.patchpatch
688062Java is not able to read landscape-oriented paper sizes (like Ledger) in PPD filesicedtea-java7MediumNewPatch for postscript.ppdpatch
688062Java is not able to read landscape-oriented paper sizes (like Ledger) in PPD filesopenjdk-6MediumNewPatch for postscript.ppdpatch
688062Java is not able to read landscape-oriented paper sizes (like Ledger) in PPD filessun-java6MediumNewPatch for postscript.ppdpatch
686000top shows unknown argument when -U is setprocpsUndecidedConfirmedtop_Username_parse.patchpatch
6840190.9.2 «put» plugin moves any window only to second viewportcompiz-fusion-plugins-mainUndecidedConfirmedfix for this issuepatch
683668file command in 10.10 produces wrong messagefileUndecidedConfirmedDiff changing compress'd with compressed.diff
683640status_of_proc is returning incorrect error codelsbMediumConfirmedUnconditionally use pidof to test if daemon is running or notpatch
683341tccat improvement proposal read by celltranscodeWishlistTriagedtccat patch to add read by cellgz
682445configure_networking doesn't wait for udev to populate available nicsinitramfs-toolsUndecidedNewPatch to wait for udevpatch
682338GTK programs in Ubuntu 10.10 are sluggish over NXcairoLowTriagedcairo_1.10.2-6.1ubuntu3.debdiffdebdiff
681646Octave function record(sec,sample_rate) doesn't work anymore in Maverickoctave3.2UndecidedConfirmedThis is actually a replacement for the record.m script.m
681617pptp stops receiving packets when bandwidth spikepptp-linuxUndecidedConfirmedPatch allows flexible tuning of MISSING_WINDOWpatch
681617pptp stops receiving packets when bandwidth spikepptp-linuxUndecidedConfirmedadj_missing_window.patchpatch
681491avra doesn't work with supplied *.inc filesavraUndecidedNewOnly for the m8def.inc file: Just comment all the # out.diff
680202w3mman2html.cgi doesn't correctly underline UTF-8 charactersw3mUndecidedNewCorrect underline processing and more UTF-8 supportpatch
678000file does not recognize most opendocument mime typesfileLowConfirmedadd opendocument mime typespatch
678000file does not recognize most opendocument mime typesfileLowConfirmedadd staroffice mime typespatch
677820php output is empty (rrdtool.so)amavis-statsUndecidedConfirmedPatch to resolve critical PHP errors in amavis-statsdiff
677378TypeError: deploy() takes exactly 1 argument (2 given)vm-builderLowConfirmedCorrected virtualbox patchtxt
677378TypeError: deploy() takes exactly 1 argument (2 given)vm-builderLowConfirmedPatch for vmbuilder virtualbox pluginpatch
676823mounting 9p file system fails intermittently in qemu guestlinuxUndecidedTriagedpatch to fix the bug (fixed)patch
676819Attaching a volume to a "pending" instance claims success, but never attaches.eucalyptusMediumConfirmed31-handlers_kvm.patchpatch
676775emma cannot insert records into tables containing a field that is a keywordemmaUndecidedNewfix-insert.diffdiff
676691viewing attachments fails when filenames have spacesflimUndecidedNewmime-conf.patchpatch
675920failure accessing large filehttpfs2UndecidedConfirmedtpot-bigfile.patchpatch
675298sbackup doesn't honor regex excludes on full backupsbackupUndecidedConfirmedsbackup.patchpatch
675223Add detection of MeeGo to os-probesos-proberWishlistTriagedPatch to /usr/lib/os-probes/mounted/90linux-distropatch
675185[Hardy SRU] dash bug causes mysqld_safe to spin at 100% CPUdashUndecidedNewfix.diffdiff
675185[Hardy SRU] dash bug causes mysqld_safe to spin at 100% CPUmysql-5.1UndecidedConfirmedfix.diffdiff
675005Update spread to version 4.1spreadWishlistIn ProgressContains a DSC file and diff.gz for spread 4.1.0tgz
674993gnome-dvb-daemon does not find channels in Estonia and Lithuaniagnome-dvb-daemonUndecidedConfirmedpatch, adding additional countries (Lithuania, Latvia, etc) for gnome-dvb-daemon 0.1.2x and 0.2gz
674745qemu segfaults when security_model not specified using virtio-9p-pci driverqemu-kvmWishlistConfirmed0002-include-a-missing-space-in-and-error-message.patchpatch
674519In the description for Lincity-ng "electricityand" should be "electricity and"lincity-ngUndecidedConfirmedFix typo "electricityand" to "electricity and" in desktop filepatch
673236maverick toolchain producing unbootable (hanging) kernelsbinutilsUndecidedNewx86: Make relocatable kernel work with new binutilspatch
673132tinyint(1) booleans for mysql connectory compatabilitydbf2mysqlUndecidedNewdbf2mysql.patchpatch
671337Minor fix of German translation [PATCH]ubiquity-slideshow-ubuntuUndecidedNewtranslation-fix.patchpatch
670901Implement easy iteratorpython-ldapUndecidedNewIterator implementationpatch
670865pam_mount not honoring options from user config filelibpam-mountUndecidedNewfuse_mount_options.diffdiff
670727can't print A5 paper correctly with cups-1.4.3(lucid)cupsUndecidedNewpstopdf.diffdiff
670511ACPI thermal procfs I/F removed from kernel 2.6.37sensors-appletUndecidedNewacpi-use-sysfs.patchpatch
670511ACPI thermal procfs I/F removed from kernel 2.6.37sensors-appletUndecidedNewuse_sysfs_in_acpi_plugin.patchpatch
670369sqliteodbc/amd64 does not compile with unixodbc-dev-2.2.14p2-1ubuntu1sqliteodbcUndecidedNewno-sqlrowcount.patchpatch
668671Amarok crashes with phonon-vlc backend phonon-backend-vlcUndecidedNew0509-x11-Partially-convert-to-XCB.patchpatch
668671Amarok crashes with phonon-vlc backend phonon-backend-vlcUndecidedNewdebdiff for vlcdebdiff
668167Please include mptfusion module versions from Linux 2.6.36linux-backports-modules-2.6.32UndecidedNew0001-add-fusion-tree-from-pristine-2.6.36.patchpatch
668167Please include mptfusion module versions from Linux 2.6.36linux-backports-modules-2.6.32UndecidedNew0002-2.6.32-s-scsi_host.h-doesn-t-have-the-SCSI_QDEPTH-en.patchpatch
668167Please include mptfusion module versions from Linux 2.6.36linux-backports-modules-2.6.32UndecidedNew0003-change_queue_depth-methods-in-2.6.32-didn-t-accept-a.patchpatch
668167Please include mptfusion module versions from Linux 2.6.36linux-backports-modules-2.6.32UndecidedNew0004-Add-packaging-goo-for-fusion-driver.patchpatch
667918Audio doesn't work with notepad's speakers, but only with headphonesalsa-driverUndecidedTriaged0001-ALSA-hda-Explicitly-specify-bios-autoprobing-for-an-.patchpatch
666565"utf8" charmap in locale name is wrongeglibcUndecidedNewReplace '.utf8' with 'UTF-8' in generated locale strings.patch
666565"utf8" charmap in locale name is wrongvimUndecidedNewReplace '.utf8' with 'UTF-8' in generated locale strings.patch
665785Support for zram (Linux >2.6.36) and ramzswap(<2.6.35) is missinginitramfs-toolsUndecidedTriagedAdditional compacache modes, zram (>=2.6.36) and ramzswap (<2.6.35)patch
665785Support for zram (Linux >2.6.36) and ramzswap(<2.6.35) is missinginitramfs-toolsUndecidedTriagedCompacache fixes for: zram (>=2.6.36), ramzswap (<2.6.35) and ramzswap (=2.6.35)patch
665720IRC as IM type for contactsevolutionWishlistNewevolution_levu_20101024.patchpatch
665561acpi_fakekey doesn't generate a "synchronization" eventacpi-supportUndecidedConfirmedacpi_fakekey.cc
665459There are some layout problems with long lineshunspellUndecidedTriagedsuggested resolution for the layout problems found in hunspell 1.2.8-6ubuntu1patch
665453tiger postrm find syntax causes warningstigerUndecidedNewpostrm.patchpatch
665412gastman doesn't support DAHDI channelsgastmanUndecidedNewkirk.patchpatch
664206SSH_AUTH_SOCK not being properly set: user has to type password even if saved in the password managerlxsessionLowConfirmedexport gk SSH_AUTH_SOCK via startlubuntupatch
663992ubumirror tries to copy the .~tmp~ directoriesubumirrorUndecidedConfirmedAbort if the remote update is in progress.patch
663962linthesia crashes with GdkGLExt-WARNING **: cannot load PangoFontlinthesiaHighConfirmeddebdiffdebdiff
663864apt-get upgrade prints incomplete repo'saptWishlistIn Progressapt-show-components-lp663864.diffdiff
663815Could not able to run the executable from the USB flash drive only in Ubuntu 10.10udisksLowConfirmedjyka-kernel-add-vfat-exe-extensions.patchpatch
663815Could not able to run the executable from the USB flash drive only in Ubuntu 10.10udisksLowConfirmedjyka-udisks-add-vfat-exe-extensions.patchpatch
663651Streamzap remote control not operating correctlylircMediumTriagedpatchpatch
663164missing support for loggingpython-daemonUndecidedNewadds logging supportdiff
663111bash_completion script errors: undefined variables, failed GLOBbash-completionUndecidedConfirmedpatch for /etc/bash_completion to fix undefined variables and failed GLOBtxt
662955AudioDevice() gets a segmentation faultpyaoUndecidedNewao_sample_format_fix.diffdiff
662813libpam-mount doesn't pass options to mount.fuse correctlylibpam-mountUndecidedNewpatch.diffdiff
662638Postinst fails if webapps/ROOT is a symlinktomcat6LowConfirmedpatch for postinstpatch
662077WxWidgets apps don't have menuswxwidgets2.6UndecidedConfirmedwxwidgets2.8_2.8.11.0-0ubuntu4.1.debdiffdebdiff
661858Add otp supportfreeradiusLowTriagedPatch to add otp supportdiff
661745reload fails with options in /etc/default/syslog-ngsyslog-ngUndecidedNewpatch against /etc/init.d/syslog-ngpatch
661308zsync fails with "aborted" when target file is redirectedzsyncMediumTriagedzsync-bug661308.diffdiff
661308zsync fails with "aborted" when target file is redirectedzsyncMediumTriagedzsync_0.6.1-1ubuntu2.debdiffdebdiff
658979alacarte still has icons in buttonsalacarteLowTriagedalacarte.patchpatch
658955Natty fails to boot on Gigabyte GA-MA78GPM-UD2HlinuxMediumIn ProgressPatch for kernel ACPI code to work around this issuetxt
658955Natty fails to boot on Gigabyte GA-MA78GPM-UD2HlinuxMediumIn Progress[PATCH] Force acpi_skip_timer_override for Gigabyte GA-MA78GPM-UD2Htxt
658471udev fails to call hid2hci for Logitech USB Bluetooth adapterbluezUndecidedTriagedfix to udev hid2hci rules for Logitech USB Bluetooth donglesdiff
658471udev fails to call hid2hci for Logitech USB Bluetooth adapterbluezUndecidedTriagednew patch for 70-hid2hci.rules, supercedes last patchdiff
658197upgrade to 10.10 breaks login if using pam_encfsencfsUndecidedNewutil-linux.debdiffdebdiff
658197upgrade to 10.10 breaks login if using pam_encfsutil-linuxUndecidedConfirmedutil-linux.debdiffdebdiff
658179GCM can not create profilegnome-color-managerUndecidedConfirmedDebdiff for g-c-m 2.32.0debdiff
657943grammatical errors in package descriptiongtkatlanticLowIn Progressgtkatlantic_0.4.2-3ubuntu1.debdiffdebdiff
657783xorg 100% cpu while using xournallibgnomecanvasLowConfirmedno-realize-if-aa.patchpatch
657613improve OOM situation handlingudevUndecidedNewdiffdiff
657473It looks like you could make SQL injection with $_POST['host'] or some other variables.smbindMediumConfirmedHere is a patched file which uses quote function to prevent injections. In addition serial calculation is fixed.php
657473It looks like you could make SQL injection with $_POST['host'] or some other variables.smbindMediumConfirmedPatched commit.php which fixes possible SQL injections and has some other minor improvements as well.php
657416eog does not save changes if image is rotated and flipped onceeogLowConfirmedBackport of bug fixes from 2.32.1patch
657357GTK Printing Dialog: Duplex printing on HP inkjets does not workgtk+2.0HighConfirmedSRU for HPLIP to switch from hpcups to hpijsdebdiff
657357GTK Printing Dialog: Duplex printing on HP inkjets does not workgtk+2.0HighConfirmedSRU for system-config-printer to prioritize hpijs against hpcupsdebdiff
656666image.toarray method generates wrong shape array for YCbCr imagespython-imagingUndecidedConfirmedPatch to fix array interface for YCbCrpatch
656541cubecolordialog.py regression with patchwxwidgets2.8UndecidedNewtrivial patch to revert regression in cubecolordialog.pypatch
656427ganglia-monitor will not start on bootgangliaMediumConfirmeddebdiff of conditional upstart/sysvinit installationdebdiff
656427ganglia-monitor will not start on bootgangliaMediumConfirmeddebdiff of upstart conversiondebdiff
656374Can't set java.library.path in /etc/default/jettyjettyUndecidedNewOriginal patches merged into a unified patchpatch
656374Can't set java.library.path in /etc/default/jettyjettyUndecidedNewetc.default.jetty.patchpatch
656374Can't set java.library.path in /etc/default/jettyjettyUndecidedNewetc.init.d.jetty.patchpatch
654667Maverick bluetooth does not create pan0 network devicesbluezUndecidedNewpatch for missing ioctlsdif
654656ubuntu-vm-builder in maverick does not build maverick VMsubuntu-vm-builderUndecidedNewpatch to allow building also maverick imagespatch
654545mountall does not honor nobootwait flag on /var/* and /usr/* filesystemsmountallHighIn ProgressDebdiff on 2.15.2 to honor noboowait flag and make /var/opt/* default to TAG_NOWAITdiff
652943Aborted output extensions create an empty fileinkscapeLowTriaged9815_9814.diffdiff
652299Package does not contain .desktop file, so dont displayed in menumascymaLowTriagedbug652299.patchpatch
651691Please merge minicom 2.4-4 (universe) from Debian unstable (main)minicomUndecidedConfirmedDebian->Ubuntu debdiffdebdiff
651691Please merge minicom 2.4-4 (universe) from Debian unstable (main)minicomUndecidedConfirmedUbuntu->Ubuntu debdiffdebdiff
651678crashes with assertion failure on startupanjutaUndecidedConfirmedWorkaround for renamed file and directory icons.patch
651678crashes with assertion failure on startupgtk+2.0LowTriagedWorkaround for renamed file and directory icons.patch
651678crashes with assertion failure on startupoxygen-moleculeUndecidedConfirmedWorkaround for renamed file and directory icons.patch
651182Invocations of "/etc/init.d/mailman start" spawns multiple instancesmailmanLowTriagedAvoid buggy '-s' implementationpatch
651010package firmware-b43-installer 4.150.10.5-4 failed to install/upgrade: subprocess installed post-installation script returned error exit status 1b43-fwcutterHighTriagedpatch for b43-fwcutter package.diff
651008Regression in wireless performance under Maverick when on battery power (broadcom)bcmwlUndecidedConfirmedpmutils-fix-bcmwl-battery-slowdown.patchpatch
649646Default ping size is incorrectly 68 bytes on x64 (Should be 56)fpingUndecidedNewfping_sizeof_fix.patchpatch
649573Underquoted definition in m4 filegtkglextmmUndecidedNewgtkglextmm.patchpatch
648644FindOpenGL.cmake does not find OpenGLcmakeUndecidedNewFindOpenGL.cmake.patchpatch
648424Export doesn't deal with different files with same filenameshotwellLowTriagedshotwell-export.patchpatch
645818Unknown keyword in configuration file: gfxbootusb-creatorHighConfirmedsyslinux_3.63+dfsg-2ubuntu3.1.debdiffdebdiff
645195LCD backlight control doesn't work for MacbookPro - patchhalUndecidedNewPatch for hal to fix the brightnessc
645130notify-osd busy polling consumes CPU and drains batterynotify-osdLowTriagedbubble.diffdiff
645058Looks for user scripts in /usr/etc and shuts downgizmodUndecidedConfirmedgizmod_3.4-0ubuntu3.debdiffdebdiff
644962Shows "P-states" text on systems without CPUfreq enabledpowertopUndecidedIn ProgressTell the user if P and C states are not availablepatch
644898required kernel toshiba support not enabledlinuxUndecidedConfirmedNew patchpatch
644898required kernel toshiba support not enabledtoshsetUndecidedConfirmedNew patchpatch
644780RTAI Patch doesn't apply over lucid's 2.6.32 kernelrtaiUndecidedNewPatch to fix the patchpatch
644632nssldap-update-ignoreusers needs to be configurable to ignore userslibnss-ldapLowConfirmedPatch to add "OK users" functionality.diff
643658ia32-sun-java6-bin has improperly equal alternatives priority on amd64sun-java6UndecidedNewia32-java-priority.diffdiff
641680ureadahead fails to link with gold linkerureadaheadUndecidedNewPreliminary patchpatch
640835WARNING: Failed to parse default value `SANT' for schema messages appear during install of gconf2 updategtodoUndecidedConfirmed0001-Move-all-GConf-default-values-outside-of-the-locale-.patchpatch
640062the md5 module is deprecated; use hashlib instead import md5pyrexLowTriagedpatchpatch
638503Gedit word select doesn't include spacegeditWishlistTriageddrag & drop word patchpatch
638418pwgen includes capital Os when generating non-ambiguous passwordspwgenMediumTriagedA patch to keep ambiguous capital letters from happeningpatch
637626would like a reasonably safe way of including https user:password data in chroot_sources/*chrootlive-buildWishlistTriagedrough patch that provides the desired functionalitypatch
636977gcl currently not built on armel, needed as a build-dependencygclUndecidedConfirmedgcl.debdiffdebdiff
636693Premature lock when launching guest sessionindicator-sessionLowIn Progressindicator-session-fix-636693.debdiffdebdiff
636223[Maverick] DAAP playlists missingrhythmboxLowNewFixes host field when manually adding DAAP sharepatch
635074Custom list controls flicker when changing search stringsoftware-centerMediumConfirmeddiff made againt latest trunkdiff
633211Fallback menus shown for windows on the blacklistfontforgeUndecidedConfirmedPatch for the fontforge Desktop filediff
632051Improve slapd postinst error message in case database directory can't be determined for a given LDAP suffixopenldapWishlistTriagedprint descriptive warning message when get_directory function can't find the database directory for the given suffixpatch
631395When upgrading from 10.04 to 10.10, exchange mail accounts no longer work in Evolution. When clicking the account, the folder structure won't expand and the account does not send or receive e-mail (although) it does appear in the send/receive dialog box. evolution-exchangeHighTriaged2.30.3-0ubuntu1_2_2.30.3-0ubuntu2.debdiffdebdiff
630561ibus no longer embed preedit textibusUndecidedNewmozc-0.12.410.102-control.patchpatch
630529Installing from USB drive writes boot sector to USB not HDDgrub-installerHighTriaged630529.patchpatch
630520chm2pdf crashed if BeautifulSoup is used but not installedchm2pdfUndecidedConfirmedCheck if beautifulsoup is installed before importing it!diff
629357[Feature Request] support xz for compressing volumesduplicityUndecidedConfirmedduplicity-lzma-write.patchpatch
628587Ubiquity 2.3.13 (oem-config) fails to create initial userubiquityUndecidedNewupdated patch for missing importpatch
626633Missing MCE remote from default config filelircUndecidedConfirmedlirc.patchpatch
626400desktop-webmail to provide mail-readerdesktop-webmailUndecidedConfirmeddebian_control.patchpatch
626382Shotwell should be mentioned instead of F-Spotubuntu-docsMediumIn ProgressBug_626382.txttxt
625877String 3592 typosearchmonkeyLowTriagedpatch.debdiffdebdiff
624787BUG: unable to handle kernel paging request at 746f6fa4 killed omnibook-kernel-modulelinuxUndecidedConfirmedCleanup compiler warningspatch
624787BUG: unable to handle kernel paging request at 746f6fa4 killed omnibook-kernel-modulelinuxUndecidedConfirmedFix "array" of structs alignmentpatch
624522Postfix init.d script and populate chroot in multi-instance environment [debian bug #560682]postfixLowTriagedpostfix-init.d--multiinstance-chroot-aware.patchpatch
623844lockpref not honored in /etc/thunderbird/pref/thunderbird.jsthunderbirdWishlistNewDebian Patch from 3.1.9-2patch
623462install to iSCSI target does not pick up iSCSI parameters from iBFTpartman-iscsiWishlistTriagedlinux-2-6-38-module-list.patchpatch
621265Slow Wireless Connection in Intel 3945abglinuxMediumConfirmedThe patch copied from Redhat's bugzilla. (0002-iwl3945-remove-check_plcp_health)patch
620959Please compile --with-solrdovecotWishlistConfirmeddovecot_fts_solr.patchpatch
620633[libjasper1 1.900.1-3ubuntu0.8.04.1 (amd64 binary) in ubuntu hardy] tries to use /tmptmp.XXXXXXXXXX as a mkstemp() templatejasperUndecidedConfirmedbug_620633.patchpatch
620432Main menu in GNOME Icon theme uses old Ubuntu icongnome-icon-themeLowNewgnome-icon-theme-fix-620432.debdiffdebdiff
620041[ubuntu-mono-dark] Inconsistent main colorubuntu-monoLowConfirmedum-dark_all_svgs_to_dfd8c8.patchpatch
619914Conjucts like rendered incorrectly in Telugu, Kannadapango1.0LowTriagedpango1.0_1.28.0-0ubuntu3~ppa1.debdiffdebdiff
619783procps will not install in multistrap unless upstart is running on the host systemprocpsUndecidedNewTrivial patch to postinstprocps
618515man page shows wrong syntax for irc:// URLsxchatLowIn Progressxchat.PatchPatch
617849php5 crashed with SIGSEGV in memcpy()php-imapMediumNewphp_imap.c.diffdiff
617823Add apport bug reporting support in sugarsugar-0.88MediumTriagedPatch for adding Report Bug Feature.debdiff
617813sugar freezes when register widget is clickedsugar-0.88CriticalConfirmed0001-Register-Bug-Solution-LP-bug-617813.patchpatch
617813sugar freezes when register widget is clickedsugar-0.90UndecidedNew0001-Register-Bug-Solution-LP-bug-617813.patchpatch
617582When opening the control panel some icons are cut off .sugar-0.88HighConfirmedModified patch (Reduced Max_Column_ Value)debdiff
617582When opening the control panel some icons are cut off .sugar-0.88HighConfirmedPatchdebdiff
617582When opening the control panel some icons are cut off .sugar-0.88HighConfirmedsugar-0.88_0.88.1-2ubuntu2.debdiffdebdiff
617101package g15daemon 1.9.5.3-8ubuntu1 failed to install/upgrade: if /dev/input/uinput is missingg15daemonMediumTriagedPatch for /etc/init.d/g15daemonpatch
616577synaptic slow search, package list change, first instalationsynapticUndecidedNewmy changesdiff
616474libetpan-dev depends on libdb4.7-dev while libdb4.8-dev is current recommended versionlibetpanUndecidedTriageddebdiff for rebuilddebdiff
616119Please remove diff-doc binary transitional packagediffutils-docLowConfirmeddiff-doc-desc.txttxt
615873Doesn't allow forcing file systems to 255 headsdosfstoolsUndecidedNewAdd -H and -t flags to override heads and sectors per trackpatch
615873Doesn't allow forcing file systems to 255 headsdosfstoolsUndecidedNewAdd -H and -t flags to override heads and sectors per track (v2)patch
615616xnec2c lacks a .desktop file.xnec2cUndecidedConfirmedA cample .desktop file for this program that doesn't provid an icon for this program (there doesn't seem to be any.)desktop
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0001-map-rebuild-map-if-it-doesn-t-exist.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0002-maps-Fix-bugs-in-map_read.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0003-mapfile-fix-bug-in-testing-for-var-run-mdadm.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0004-mapfile-allow-the-path-name-to-the-device-to-be-empt.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0005-mapfile-Fix-off-by-one-error-in-RebuildMap.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0007-fix-add_dev-handling-of-broken-links.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0008-Fix-an-error-when-assembling-arrays-that-are-in-the-.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0009-Adjust-major-number-testing-to-allow-for-extended-mi.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0010-mapfile-when-rebuilding-choose-an-appropriate-name-i.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0011-Rename-open_mddev-to-create_mddev.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0012-Incremental-lock-against-multiple-concurrent-additio.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0013-Add-locks-for-Manage_runstop.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0014-Bug-fixing-for-mdadm-map-file-reading-and-dev-name-c.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0015-Partition-creation-logic-fixing.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0017-Fixed-locking.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0018-Initramfs-to-set-hostname-for-autoassembly.patchpatch
615186md_d0 array fabricated, prevents mounting md0 partitionsmdadmUndecidedIn Progress0019-Always-set-homehost-if-not-specified.patchpatch
614907Add suppport for IEEE 802.15.4 hardware in net-toolsnet-toolsWishlistNewadd802154add802154
614662A better mountallmountallUndecidedConfirmedmountall2.tar.gzgz
614394ERROR root: No gsm connection was set in GConf.sugar-0.88LowIn ProgressRevised patch: Thanks to alsrootpatch
614394ERROR root: No gsm connection was set in GConf.sugar-0.88LowIn Progressgsm.patch to change the loggign level from error to debugpatch
614388Sugar emulator should start in fullscreen modesugar-0.88UndecidedIn Progresspatch made for the solution. Now sugar emulator will start always in fullscreen modepatch
614151depends sword-text-rst don't existsword-language-packsUndecidedConfirmedpatch.diffdiff
613825mountall races with statd startupmountallUndecidedConfirmedPatch for mountall-net.confpatch
613825mountall races with statd startupmountallUndecidedConfirmedTrigger mountall-net when statd finishes startingpatch
613743update-manager cpu-bound for a long time openingpython-aptLowNewFix to address excessive progress bar updates causing issuedebdiff
613662nscd doesn't cache host entrieseglibcMediumTriagedDebdiff to restore functionality disabled by a non-bugdebdiff
613461modutil et. al. segfault using PKCS11 api libopencryptokiUndecidedNew05-fix-ro-access.patchpatch
613231Option to quiet /lib/init/upstart-jobs [RFE,PATCH]upstartWishlistConfirmedPatch for upstart-0.6.5 and upstart-0.6.6 (on top of Debian/Ubuntu diff)patch
613231Option to quiet /lib/init/upstart-jobs [RFE,PATCH]upstartWishlistConfirmedReplacement upstart-job scriptpatch
612310dmsetup rename sometimes creates new device name but does not remove original device namelvm2UndecidedNewcryptdisks.functions.diffdiff
611364formatted copyright file errorslibgphoto2LowTriagedbzr_diff.patchpatch
611189fix for axis trouble in joystick codegngbLowTriagedmemory.c.diffdiff
611020/lib/udev/iphone-set-info consumes 99% CPU libgpodUndecidedConfirmediphone-cpu-usage.patchpatch
610975relocation error with latest wxwidgets2.8wxwidgets2.8MediumTriagedrebuild package for 64 bit versiongz
610869mountall ignores nofail mount optionmountallHighTriagedreel-mountall-nofail.diffdiff
610300package likewise-open 5.4.0.42111-2ubuntu1.1 failed to install/upgrade: subprocess installed post-installation script returned error exit status 1likewise-openUndecidedConfirmeddeb.diffdiff
610206Build in input drivers for speedxorg-serverWishlistTriaged201_Add-inputclass-section-into-builtin-config.patchpatch
610125pam_motd runs commands as root with unsanitised environmentpamLowTriaged610125.patchpatch
610108invalid (formatted) copyright syntaxbase-passwdUndecidedConfirmedfix-copyright-patch-except-for-PDfix-copyright-patch-except-for-PD
609530uptimed lost all records during unsuccessful suspenduptimedUndecidedConfirmedpatchpatch
608767dpkg expects capital letters in DistUpgradeViewKdeupdate-managerUndecidedNewsimpleFix.patchpatch
608718While keyer is open, in RX(RST) field crashes XlogxlogUndecidedConfirmed608718.diffdiff
608182problems with ups (mge pulsar es 8+)nutLowTriagedPyNUT-rw-except.diffdiff
608112in debian/extra, amrwb shall be renamed to amrwbencgst-plugins-bad0.10UndecidedNewextra-amrwb.patchpatch
607988Make it easier to translate files found messagecatfishUndecidedConfirmedmessages_po.diffdiff
607902python version mismatchlabyrinthUndecidedNewPatch to replace the static version-specific package inclusion with one calculated from the actual package locationdiff
607084Fetching POP3 Mail in KMail sometimes failskdepimlibsUndecidedNewpop3-fix-memcpybug.patchpatch
605475Launcher does not respond to changes in icon themeunity-2dUndecidedConfirmed605475.patchpatch
605428When input file is complete, zsync should stopzsyncWishlistTriagedzsync-stop-on-complete.patchpatch
604717Please convert init script to upstartntpWishlistTriagedpatchpatch
604525nvidia-settings "Configure Display Device" menu should be drop-down list instead of dialog boxnvidia-settingsWishlistTriagedbug604525.patchpatch
604335grub-pc.postinst script fails to detect virtio vda disk in KVM guestgrub2HighTriagedgrub2_1.98-1ubuntu12.debdiffdebdiff
604131Pattern along Path errors outinkscapeLowTriaged9721_9720.diffdiff
602832system-config-printer-gnome description in software center geeky and incompletesystem-config-printerLowConfirmedcontrol.patchpatch
602767exe thumbnailer eats all memory while thumbnailing large filesgnome-exe-thumbnailerMediumTriagedmax_filesize_using_gconf_natty.patchpatch
600350[SRU] Upstream patch increaes performance when transferring multiple small filesproftpd-dfsgUndecidedNewJaunty patchdebdiff
599478touch inputs do not rotate when screen rotatesgnome-desktopLowTriaged101_rotate-touch-devices.patchpatch
598385munin plugin exim_mailqueue has incorrect graph configurationmuninLowTriagedPatch for /usr/share/munin/plugins/exim_mailqueuediff
598385munin plugin exim_mailqueue has incorrect graph configurationmuninLowTriagedmunin_1.4.6-3ubuntu3.debdiffdebdiff
598025setools could be split between GUI and non-GUI toolssetoolsWishlistConfirmeddebdiff against setools package to split out setools-guidebdiff
597859Wrong application name appears in Sound Preferences when using pulseaudiolibsdl1.2LowTriageddont-specify-appname.patchpatch
595884the boolean components are not available in ksimusksimus-booleanUndecidedConfirmedSmall configure script patchpatch
595464Russian localization/minor issuesrubricaUndecidedNewrub.diffdiff
594839Plymouthd SIGSEGV on Lucid Xen InstanceplymouthUndecidedTriagedplymouth.patchpatch
594827broken bmc-watchdog init script/logrotate configfreeipmiUndecidedConfirmedtgz with new init script and logrotate patchgz
594773log spam: DeprecationWarning: the md5 module is deprecatedlibapache2-mod-pythonUndecidedConfirmedimporter.py.patchpatch
594614Add 'snapshot_create' as monitor commandqemu-kvmWishlistTriagedsnapshot_create-add.patchpatch
592370Minor enhancementscatfishUndecidedNewTooltips deprecation fixdiff
592370Minor enhancementscatfishUndecidedNewpp2_patch.diffdiff
592330Running an executable gives a "root access is required" error instead of prompting for a passwordnautilus-actionsUndecidedIn Progressrun-as-admin.shsh
592330Running an executable gives a "root access is required" error instead of prompting for a passwordnautilus-actionsUndecidedIn Progressrun-as-adminstrator.schemasschemas
591969dd: cryptic error message when bs=coreutilsLowTriagedbetter error message for unreasonably large blocksizespatch
591475Spurious abort message after successful pvmovelvm2MediumTriagedlp591475_pvmove_race.patchpatch
591119Telepathy-butterfly leaks memorytelepathy-butterflyLowTriagedpapyon.patchpatch
590924Broadcom STA (bcmwl) driver fails to build with 2.6.35-1 kernelbroadcom-staMediumConfirmedmaverick-bcmwl-mclistmaverick-bcmwl-mclist
590160firestarter does not launch from gnome main menu or from terminalfirestarterUndecidedNewEdited 12_firestarter_transparent_icon.dpatchdpatch
590128PC/SC Omnikey Handler is missing the hotplug scriptpcsc-omnikeyUndecidedNewA diff file (from pcsc-omnikey 1:3-3ubuntu1) for Maverick, containing the hotplug fix for the bug.gz
589890can't close pidgin conversations when opened with messaging-menupidgin-libnotifyMediumTriagedcorrectly show conversation to userpatch
589496bash --rcfile does not behave as documentedbashUndecidedConfirmedDo not execute /etc/bash.bashrc if --rcfile is setpatch
589042jmeter-server fails to start due to 127.0.1.1-bindingjakarta-jmeterUndecidedNewImproved adress resolution for the server startuppatch
589042jmeter-server fails to start due to 127.0.1.1-bindingjakarta-jmeterUndecidedNewUse DNS for finding IP for java.rmi.server.hostnamepatch
588859python-mysqldb silently drops exceptions on deadlockspython-mysqldbUndecidedNewAdd necessary error check.diff
588475Incorrect check message for maintainer modeautomake1.11LowNewFix message about maintainer modepatch
588093cvMixChannels completely brokenopencvUndecidedNewOpenCV revision r2249 diffdiff
587973Missing symlinks in tofrodos packagetofrodosUndecidedConfirmedalternatives.patchpatch
587399Fix NBD Live CD Support in Ubuntu caspercasperWishlistNewNBD Live-CD Boot Patch, tested on Lucidpatch
587301Typo in package description.mysql-query-browserLowConfirmedmysql-gui-tools_5.0r14+openSUSE-2.1ubuntu1.debdiffdebdiff
587272gajim doesn't have indicator supportgajimWishlistConfirmedindicator.0.13.4.diffdiff
587272gajim doesn't have indicator supportgajimWishlistConfirmedindicator.diffdiff
586814custom (pgk) translations preempted by lang packgrub2WishlistTriaged985_prefer_locale_to_langpack.patchpatch
586756update-grub ignores pvops kernels on Xen domUgrubUndecidedNewPatch for /usr/sbin/update-grubpatch
586226In external .gtkrc file for selected theme cannot be used styles for some of items in the lock windowgnome-screensaverMediumTriagedPath to resolve the issue.diff
585408aptitude returns 0(=OK) even if install failsaptitudeUndecidedConfirmedPatch to make aptitude barf when it can't deliver the requested package versionpatch
584942libnfsidmap2: Virtual domains/users handling with at sign in idmaplibnfsidmapUndecidedNewlibnfsidmap_0.20-1_fix_at_sign_user_with_domain.diffdiff
584942libnfsidmap2: Virtual domains/users handling with at sign in idmaplibnfsidmapUndecidedNewlibnfsidmap_0.21_up_fix_at_sign_user_with_domain_plus_realm_fix.diffdiff
584941Numerous warnings with Murrine-based themescommunity-themesUndecidedConfirmedmurrine-themes.patchpatch
584386regression: sony vaio ar71vgn brigntness keys not work (not even OSD)acpiUndecidedNew/etc/acpi/events/sony-brightness-downsony-brightness-down
584386regression: sony vaio ar71vgn brigntness keys not work (not even OSD)acpiUndecidedNew/etc/acpi/events/sony-brightness-upsony-volume-up
583933test results in php5-common are more than 1 MiB larger than last uploadphp5LowConfirmedlp_583933.patchpatch
583216inet_protocols can't be preseededpostfixMediumConfirmedpostfix_protocols_preseed.patchpatch
582265Init script accept to set RSYNC_NICE > 19rsyncLowConfirmedWarn when RSYNC_NICE is > 19diff
582265Init script accept to set RSYNC_NICE > 19rsyncLowConfirmedinit.d.diffdiff
581753input methods name clash: zhuyin and bopomofom17n-dbUndecidedConfirmedbzr bundle for the changezhuyin-name
581230DarkRoom: Evolution preferences not displaying correctlyhuman-themeLowTriagedSpecify panel mail items onlypatch
580961unzip fails to deal correctly with filename encodingsunzipHighTriagedunzip_7.0-ubuntu1_i386.debdeb
580590Squid no longer uses $SQUID_MAXFDsquidWishlistConfirmedsquid.upstart.patchpatch
580408Option 'No' at question 'Continue without installing GRUB?' does nothing. Forced to answer 'Yes'.grub2HighTriagedreduced patch, with 'diff -bu'patch
578593"About %s remaining" should support plural formslanguage-pack-heUndecidedNewDisfUdgrideView.diffdiff
578593"About %s remaining" should support plural formslanguage-pack-heUndecidedNewDisfUdgrideViewGtk.diffdiff
578593"About %s remaining" should support plural formslanguage-pack-heUndecidedNewDisfUdgrideViewKDE.diffdiff
578593"About %s remaining" should support plural formsupdate-managerLowNewDisfUdgrideView.diffdiff
578593"About %s remaining" should support plural formsupdate-managerLowNewDisfUdgrideViewGtk.diffdiff
578593"About %s remaining" should support plural formsupdate-managerLowNewDisfUdgrideViewKDE.diffdiff
578506[Kernel] ACPI: EC: input buffer is not empty, aborting transactionlinuxUndecidedConfirmedACPI EC kernel patchdiff
578506[Kernel] ACPI: EC: input buffer is not empty, aborting transactionlinuxUndecidedConfirmedDifference file for kernel 3.0.0 ec.cdiff
578506[Kernel] ACPI: EC: input buffer is not empty, aborting transactionlinuxUndecidedConfirmeddiff file for ec patchc
578213Add more common flac sample ratesfileUndecidedConfirmedAdd flac sample rates 88.2kHz and 96kHzpatch
578109plymouth copying progress counter for copy_live_to()casperWishlistTriagedAdd progress bar to plymouth splash for the copy_live_to() functionpatch
578014Two minor bugscatfishUndecidedConfirmednew version: catfish.pydiff
578014Two minor bugscatfishUndecidedConfirmednew version: messages.pot (in po/)diff
578014Two minor bugscatfishUndecidedConfirmedrespl.patchpatch
577902Night Impressions warning fix for Murrine scrollbar_color not supportedcommunity-themesUndecidedNewcommunity-themes-0.22.1_night-impression.patchpatch
577706martion-modem daemon creates device file with wrong permissionsmartian-modemUndecidedNewChange to the default to specify the modeetc_default_martian-modem
577706martion-modem daemon creates device file with wrong permissionsmartian-modemUndecidedNewUpdate to init script to read mode from default filed_martian-modem
577622No notifications for IRC messagespidgin-libnotifyWishlistTriagedpidgin-libnotify.c.diffdiff
577302ubiquity crashes with error: "InstallStepError: Plugin usersetup failed with code 32"ubiquityUndecidedConfirmedpatch for /usr/lib/ubiquity/user-setup/user-setup-applypatch
576750SVN client does not work due to Certificate verification errorneon27UndecidedConfirmedneon27-tls_md5.patchpatch
576243[SRU] rcmdr .desktop file fails to create child processrcmdrMediumTriagedrcmdr_desktopfilefix.debdiffdebdiff
575978Wrong keys in icelandic keyboard layoutxkeyboard-configMediumTriagedApplies the described change to /usr/share/X11/xkb/symbols/isdiff
575918cryptkeeper crashes while switching user on lucidcryptkeeperUndecidedNewcryptkeeper_patch.diffdiff
575918cryptkeeper crashes while switching user on lucidcryptkeeperUndecidedNewencfs_wrapper.diffdiff
575812 revtex4-1 should be upgraded to bugfix release on 3/15/2010texlive-extraUndecidedConfirmed.debdiff with REVTeX 4.1rdebdiff
575387support excludes in the sniffer testchkrootkitWishlistTriagedsnifferexclude.patchpatch
575335indicator-applet uses extremely large amounts of memoryindicator-appletMediumTriagedpatch to unref original pixbuf after resizingpatch
575154dashism in checkroot/checkfs/usplash functionssysvinitUndecidedNewdebdiff fixing this issue, for Hardy, testeddebdiff
575107evince crashed with SIGSEGV in Parser::getPos()popplerMediumConfirmedGfx parser initializationdiff
575026xfstt crashes in lucid lynxxfsttUndecidedNewpatch correcting buffer overflow in sprintf callpatch
574185phppgadmin cannot dump in sql formatphppgadminUndecidedNew/usr/share/phppgadmin/dbexport.phpphp
573919NIS-based autofs maps don't load on startupautofsMediumIn ProgressTeach statd about autofsfix
572832xmms2tray notifications (and other features) don't workxmms2trayUndecidedNewPatch to fix notificationsdiff
572832xmms2tray notifications (and other features) don't workxmms2trayUndecidedNewsame, but diff -udiff
572582catfish menu resize errorcatfishUndecidedConfirmedwidth.diffdiff
572260package python-gmenu 2.30.0-0ubuntu4 failed to install/upgrade: subprocess installed post-installation script returned error exit status 2gnome-menusUndecidedNewpostinst.patchpatch
572110scary message on live cd installingubiquityLowTriagedubiquity.patchpatch
571707fsck progress stalls at boot, plymouthd/mountall eats CPUplymouthUndecidedTriagedmountall_2.14-0ubuntu1.debdiffdebdiff
571707fsck progress stalls at boot, plymouthd/mountall eats CPUplymouthUndecidedTriagedmountall_2.14_lp571707.debdiffdebdiff
571707fsck progress stalls at boot, plymouthd/mountall eats CPUplymouthUndecidedTriagedplymouth_0.8.0-2ubuntu2_lp571707.debdiffdebdiff
571707fsck progress stalls at boot, plymouthd/mountall eats CPUplymouthUndecidedTriagedplymouth_0.8.2-2ubuntu3.debdiffdebdiff
571701photoprint crashed with SIGSEGV in g_cclosure_marshal_VOID__VOID()photoprintMediumConfirmedworkaroundpatch
571473add support for application indicatorcryptkeeperHighConfirmed0001-Added-basic-support-for-appindicator.patchpatch
571473add support for application indicatorcryptkeeperHighConfirmed0002-Update-the-menu-when-mounting-unmounting.patchpatch
571473add support for application indicatorcryptkeeperHighConfirmed0003-Remove-markup-and-fix-menu-updates.patchpatch
571369gWaei 1.2.1 segfaults on any action (lucid_x64)gwaeiUndecidedConfirmedgwaei_1.2.1-1ubuntu1.debdiffdebdiff
571094SIGSEV in JRE quits vuze [on loss of connection ]openjdk-6MediumConfirmedazureus-startscript-patch.patchpatch
571038palimpsest crash with libgdu:ERROR:gdu-pool.c:2369:device_recurse: assertion failed: (depth < 100)gnome-disk-utilityHighTriagedudisks needs to be patched to close this bugpatch
570858Can't install dvipsk-ja in Lucid Lynxdvipsk-jaUndecidedConfirmeddebdiff for 5.96+jp1.7a-3.1build1 and 5.98+p1.7b-1ubuntu1~lucid1debdiff
570812Use the ubuntu startpage by defaultchromium-browserWishlistConfirmedchromium-browser_5.0.375.70~r48679-0ubuntu3.debdiffdebdiff
570812Use the ubuntu startpage by defaultchromium-browserWishlistConfirmedchromium-master-prefs-path.patchpatch
570802spurious echo causes extra mail when running from cronchkrootkitLowConfirmedno newline if quietpatch
570448cannot compose new message, broken popup.jsimp4UndecidedNewworkaround replacing broken filejs
569685modem manager anydata adu 635modemmanagerUndecidedNewadding anydata gsm pluginpatch
569646[Lucid] Updated dynamic key mappings for Hauppauge "mceusb" remotemythbuntu-control-centreUndecidedNewremote.diffdiff
568988[Lucid][Ubuntu 10.04][ATI cards] Slow/freeze windows management (resize, maximise, .etc) with fglrx driver + compositing desktop.fglrx-installerUndecidedConfirmedFelix Kuehling's xserver-xorg-backclear patchpatch
568988[Lucid][Ubuntu 10.04][ATI cards] Slow/freeze windows management (resize, maximise, .etc) with fglrx driver + compositing desktop.fglrx-installerUndecidedConfirmedfglrx-2.6.34-rc4.patchpatch
568823Improved Java Memory/Performance Defaultstomcat6WishlistConfirmedtomcat6.mem.diffdiff
568401Indicator applets open when pressing S or M key via NX, VNCgnome-doUndecidedNewgnome-do-no-grab-without-mods.patchpatch
568401Indicator applets open when pressing S or M key via NX, VNCgnome-doUndecidedNewindicator-no-grab-without-mods.patchpatch
568275No JS in 0.12.0~svn2018-6ubuntu2mediatombWishlistTriagedDiff against Version mediatomb_0.12.0~svn2018-6ubuntu2diff
567512uinput broken for at least Mac minilircUndecidedConfirmedDebdiff to fix this bug in luciddebdiff
567030amaespipe depends on uuencode but package does notamandaUndecidedNewamaespipe.patchpatch
566812USB Modem wont connect after modem hangupnetwork-managerUndecidedConfirmedPatch for 10.04 (network-manager_0.8-0ubuntu3.2)patch
566812USB Modem wont connect after modem hangupnetwork-managerUndecidedConfirmedlp566812_reconnect_if_modem.patchpatch
566441pycompile defaults to python 2.5, should use python 2.6 in Lucidpython-defaultsMediumTriageddebdiff releasing as 2.6.5-0ubuntu1.1debdiff
566441pycompile defaults to python 2.5, should use python 2.6 in Lucidpython-defaultsMediumTriageddebdiff releasing as 2.6.5-0ubuntu2debdiff
566023Terratec Aureon Dual USB sound card is listed without correct nameusbutilsWishlistNewpatch which adds a name for USB id 0ccd:0077patch
565777unixserver appears to lack SO_PEERCRED supportucspi-unixUndecidedNewp1p1
565375Doesn't work on Debian, because using is_alive instead of isAliveusb-creatorMediumTriagedisAlive.diffdiff
565375Doesn't work on Debian, because using is_alive instead of isAliveusb-creatorMediumTriagedis_alive.diffdiff
564698lscpu command shows "???" when messages are translated in Japaneseutil-linuxLowConfirmedlscpu.c.patchpatch
564641Bad address during writev in weak_crypto modekrb5-applUndecidedNewFix for kcmd.cpatch
564633system-config-printer: make driver installation optionaljockeyUndecidedNewPatch to make a Kyocera printer detected if it reports only the model name and not the manufacturer namepatch
564607timemodule.c: Python loses current timezonepython2.6UndecidedNewpatch from upstream bugdiff
564476OverflowError, "long int exceeds XML-RPC limits"denyhostsUndecidedConfirmedChange line 55 of sync.py, "a" -> "w"patch
564472When I booting with Lucid Beta2 live CD, my soundcard is muted with first timealsa-utilsUndecidedNewThis is the Oneiric alsa-utils version compatible patchpatch
564472When I booting with Lucid Beta2 live CD, my soundcard is muted with first timealsa-utilsUndecidedNewTis patch resolves my Nvidia soundcard experienced muting problempatch
563726missing /etc/default/zabbix-* fileszabbixUndecidedNewTrivial patchpatch
563545Fancontrol should not stop at reboot and shutdownlm-sensors-3UndecidedNewfancontrol-no-stop-on-shutdown-reboot.patchpatch
563276No way to tweak multi-finger tap reactiongnome-settings-daemonWishlistTriaged0001-Add-tap-to-click-button-settings.v8.patchpatch
563276No way to tweak multi-finger tap reactiongnome-settings-daemonWishlistTriaged06_add_corner_tapping_button_settings.patchpatch
563276No way to tweak multi-finger tap reactiongnome-settings-daemonWishlistTriaged06_add_tap-to-click_button_settings.patchpatch
563276No way to tweak multi-finger tap reactiongnome-settings-daemonWishlistTriaged06_change_tap-to-click_defaults.patchpatch
563269drapes won't autostartdrapesUndecidedConfirmeddrapes-0.5.2-5.diffdiff
563179svn crashes when checking out when saving credentials in kwalletsubversionMediumConfirmedkwallet-delete-oncekwallet-delete-once
562948Upgrade 8.04 LTS -> 10.04 LTS fails at circular dependency with openoffice.org extensionsupdate-managerHighConfirmeda suggestion on how to fix the bug for lucid upgradespatch
560807ifconfig does not display inet6 addressesnet-toolsUndecidedNewnet-tools-libinterface.patchpatch
560703package yiff-server 2.14.5-5.1 failed to install/upgrade: subprocess installed post-installation script returned error exit status 1yiffMediumTriagedyiff_2.14.5-5.1ubuntu0.10.04.1.debdiffdebdiff
560491[lucid beta2] Plymouth does not honor "nosplash"plymouthLowTriagedFix plymouth's keyword check in kernel command linediff
559939[USB-Audio - USB AUDIO ] no volume control possible with Tenx USB audio adapteralsa-driverUndecidedConfirmedA patch that applies to linux 3.1-rc1patch
559847Please support /etc/X11/Xreset.dgdmWishlistTriagedgdm.diffdiff
559847Please support /etc/X11/Xreset.dlightdmWishlistTriagedgdm.diffdiff
559797RGB to [0,1] normalization uses wrong divisorplymouthLowTriagedplymouth-theme-ubuntu-logo-rgb-normalize.patchpatch
559745NC failed to start a session with a libvirt internal erroreucalyptusMediumConfirmedgen_kvm_libvirt_xml.diffdiff
559047"parted print" crash in en_GB.utf8 localepartedMediumTriagedfixpatch
558631vertical gnome-panel menu bar is layed out backwardsgnome-panelLowTriagedPatch to switch the left-hand-side menu bar orderingpatch
558581Indicator-applet forcibly overrides Super+m key comboindicator-appletLowTriagedPatch that disables the hotkeydiff
558581Indicator-applet forcibly overrides Super+m key comboindicator-appletLowTriagedPatch to disable forced hotkeys for indicator-appletpatch
558581Indicator-applet forcibly overrides Super+m key comboindicator-messagesUndecidedConfirmedPatch that disables the hotkeydiff
558581Indicator-applet forcibly overrides Super+m key comboindicator-messagesUndecidedConfirmedPatch to disable forced hotkeys for indicator-appletpatch
558347Autosave is not workingpyroomUndecidedNewautosave.patchpatch
558347Autosave is not workingpyroomUndecidedNewautosave2.patchpatch
557393Conduit does not work properly with UTF-8 locations for rhythmbox playlistsconduitUndecidedConfirmedpatchpatch
557013Add pam-config for pam_mkhomedir.sopamWishlistTriagedpam_mkhomedir.so pam-config for interactive sessions onlymkhomedir
556167vmbuilder uses parted to create disk images, which leads to broken sector counts (cannot use grub2 on disk images created by vmbuilder/parted)partedUndecidedConfirmedembedding-area-hack.patchpatch
556167vmbuilder uses parted to create disk images, which leads to broken sector counts (cannot use grub2 on disk images created by vmbuilder/parted)vm-builderMediumConfirmedembedding-area-hack.patchpatch
555828Regression: flag "-pg" on /usr/src/$(uname -r)/Makefile prevents acerhk-source package from compiling. Computer becomes unusable because there is no equivalent to acerhk in the kernel.acerhkUndecidedIn Progressacerhk-source_lp_bug555828-2.6.32.patchpatch
555828Regression: flag "-pg" on /usr/src/$(uname -r)/Makefile prevents acerhk-source package from compiling. Computer becomes unusable because there is no equivalent to acerhk in the kernel.acerhkUndecidedIn Progressacerhk-source_lp_bug555828-2.6.35.patchpatch
555828Regression: flag "-pg" on /usr/src/$(uname -r)/Makefile prevents acerhk-source package from compiling. Computer becomes unusable because there is no equivalent to acerhk in the kernel.acerhkUndecidedIn Progressacerhk-source_lp_bug555828-2.6.37.patchpatch
555828Regression: flag "-pg" on /usr/src/$(uname -r)/Makefile prevents acerhk-source package from compiling. Computer becomes unusable because there is no equivalent to acerhk in the kernel.acerhkUndecidedIn Progressacerhk-source_lp_bug555828-2.6.38.patchpatch
555828Regression: flag "-pg" on /usr/src/$(uname -r)/Makefile prevents acerhk-source package from compiling. Computer becomes unusable because there is no equivalent to acerhk in the kernel.acerhkUndecidedIn Progressacerhk-source_lp_bug555828.patchpatch
555096[PATCH] Search function can't find "\xff" "\xf0" "\x90" (number above 0x80)hexerUndecidedNewregex matcher uses unsigned char.diff
554063Calling dspam from amavisd-new failsamavisd-newLowTriagedRemoves unnecessary arguments form dspam callpatch
553736Unable to establish an ytalk chatnetkit-ntalkUndecidedNewOld and dirty hack that made ytalk 3.3.0 work for mediff
553736Unable to establish an ytalk chatytalkUndecidedTriagedOld and dirty hack that made ytalk 3.3.0 work for mediff
553567transition from plymouth to kdm not smoothkde-workspaceMediumConfirmedkdm-plymouth-autologin.patchpatch
553557kde power button configuration ignoredacpidUndecidedConfirmedpowerbth.diffdiff
553141awn-settings crashed with AttributeError in register_applet()avant-window-navigatorMediumTriagedawn-install-3rd-party-applets.patchpatch
553106hamlib plugins for gsatpredictUndecidedIn Progressrigctld and rotctld plugins for gsatdiff
552575convenient support for live CDs images in /bootgrub2WishlistTriagedput 50_casper in /etc/grub.d50_casper
552568hamlib rotctld supportpredictUndecidedIn Progressrotctld support and manual pagediff
552568hamlib rotctld supportpredictUndecidedIn Progressrotctld support for predict-g1yyhdiff
551147Shift Keys do not work in VNCx11vncLowConfirmedSimple patch for mythbuntu session.shpatch
551055Problems when booting an encrypted lvm containing btrfscryptsetupUndecidedConfirmedLucid patch for btrfs root partition on crypto devicediff
551055Problems when booting an encrypted lvm containing btrfscryptsetupUndecidedConfirmedcryptsetup.diffdiff
551055Problems when booting an encrypted lvm containing btrfscryptsetupUndecidedConfirmedgutschke's patch adapted for Ubuntu Karmicdiff
550474Bad handling of zero-length writesexpectUndecidedNewPatch that fixes the problem.dpatch
550056Incorrect parsing of utf16 byte order marklibid3tagUndecidedNewutf16.c.diffdiff
549950compiz (cube) - Warn: Failed to load slide: /usr/share/gdm/themes/Human/ubuntu.pngcompizUndecidedConfirmedcube.xml.diffdiff
549682provide emergency path for when entire initscripts are brokengrub2UndecidedNewgrub2_10_linux.patchpatch
549447eGalax touchscreen configured as tabletxserver-xorg-input-evdevMediumTriagedxserver-xorg-input-evdev-2.6.0-jarfil_20110723a.patchpatch
549117users are not added to "users" group (empty, broken behaviour)adduserUndecidedConfirmedre-enable-EXTRA_GROUPS-users.patchpatch
546922[lucid] Some suggestions with new gfxboot artworkgfxboot-theme-ubuntuWishlistConfirmedUnfortunately this patch do isolinux/text.cfg modification, but not create the isolinux/isolinux.txt file.patch
546881protocol icons (particularly Facebook) obscure status icon too muchempathyLowTriaged16x16px icon remade + shifted to the leftpng
546745libvirt tries to read /etc/sasl/libvirt.conf not /etc/sasl2/libvirt.conf despite docslibvirtLowConfirmedsasl.patchpatch
545852Alltray 0.69 Icons have wrong backgrounds in Lucid Beta1alltrayUndecidedNewPatch for getting rid of the wrong background color in alltraypatch
545062[lucid] icon in status bar not correctly transparentgajimLowConfirmeduse-gtkstatusicon.patchpatch
545062[lucid] icon in status bar not correctly transparentgnome-python-extrasLowConfirmeduse-gtkstatusicon.patchpatch
543266preview latex fails with pdflatexauctexHighTriagedpatch for pdf2dsc from debian ghostscript 8.71~dfsg-3patch
543183Updating system certificates requires rebuildfirefoxWishlistTriagedF14 1.9.2 patch to allow use of system certificate storepatch
542068Missing translations for "xterm failsafe session"gdmLowNewAdd desktop files to POTFILES.inpatch
542068Missing translations for "xterm failsafe session"gdmLowNewMake the desktop files translatablepatch
542042Regression: skype webcam (Chicony CNF7129) image very dark on Asus 1000HE on Lucid LTS (10.4) UNElibv4lUndecidedConfirmedWork around the problem by introducing a new RESTRICT_FRAME_RATE quirk that disables all the frame rates except the default onepatch
541511MASTER: [i855] GPU lockup (apport-crash)linuxUndecidedConfirmedRe-enable DRI on 855 and 845debdiff
541511MASTER: [i855] GPU lockup (apport-crash)linuxUndecidedConfirmedwhole patch against lucids linux 2.6.32-21.32diff
541511MASTER: [i855] GPU lockup (apport-crash)xserver-xorg-video-intelWishlistTriagedRe-enable DRI on 855 and 845debdiff
541511MASTER: [i855] GPU lockup (apport-crash)xserver-xorg-video-intelWishlistTriagedwhole patch against lucids linux 2.6.32-21.32diff
540280openssh (or gvfs) asks for a password everytime I change directory in sftpbzr-gtkMediumTriagednautilus-bzr_sftpfix.py.diffdiff
540280openssh (or gvfs) asks for a password everytime I change directory in sftpgvfsMediumTriagednautilus-bzr_sftpfix.py.diffdiff
540192Button text mess-up in users and groups windowgnome-system-toolsMediumTriaged0001-Don-t-limit-users-list-s-width-request.patchpatch
539912current battery charge not easily accessiblegnome-power-managerWishlistTriagedCompacts time format to hh:mmpatch
539912current battery charge not easily accessiblegnome-power-managerWishlistTriageddisalbes application indicators and brings back tooltips and percentagepatch
539912current battery charge not easily accessiblegnome-power-managerWishlistTriagedpercentage.debdiffdebdiff
539888441: /usr/share/resource-agents/ResourceManager: not foundheartbeatUndecidedConfirmedshellfuncs.diffdiff
539814tar: futimens() with a bad file descriptor (AT_FDCWD) causes bootstrapping failure with kernels < 2.6.22debootstrapWishlistTriagedCherry picked changes to gnulibdebdiff
539814tar: futimens() with a bad file descriptor (AT_FDCWD) causes bootstrapping failure with kernels < 2.6.22debootstrapWishlistTriagedDebdiff for tar-1.22 with added tar-futimens patch from debian bug report.debdiff
539814tar: futimens() with a bad file descriptor (AT_FDCWD) causes bootstrapping failure with kernels < 2.6.22debootstrapWishlistTriagedPatch from above debian bug, which fixes this.patch
538884No appropriate method for modifying specfic menuentrygrub2WishlistTriaged07_custom07_custom
538884No appropriate method for modifying specfic menuentrygrub2WishlistTriaged10_linux10_linux
538747gparted should use SI prefix instead of IEC prefix as defaultgpartedWishlistTriagedgparted_0.5.1-1ubuntu3.patchpatch
538747gparted should use SI prefix instead of IEC prefix as defaultgpartedWishlistTriagedgparted_0.5.1-1ubuntu3v2.patchpatch
538669ntfsclone is slow when backing up to NTFSlinux-ntfsUndecidedNewProof of concept patch for ntfsclone.c, removing unnecessary lseek()s in the output file; breaks other things.patch
537854Brother printers do not accept changes to default printer settingsbrother-cups-wrapper-commonUndecidedNewFix buffer overflow with strncpybuffer_overflow_strncpy_fix
537854Brother printers do not accept changes to default printer settingsbrother-cups-wrapper-commonUndecidedNewFix index out of range errorindex_out_of_range
537854Brother printers do not accept changes to default printer settingsbrother-cups-wrapper-commonUndecidedNewIncrease input buffer to prevent overflowbuffer_overflow
537133mountall issues with NFS root filesystemmountallMediumIn Progressmountall.c.is_root.patchpatch
537133mountall issues with NFS root filesystemmountallMediumIn Progressmountall_2.15_child-watch-list-race-condition-fix.patchpatch
535446[lucid] Blueman Pulseaudio plugin cannot be loadedbluemanUndecidedConfirmedDoesn't barf on unsuccessful property changes anymorepatch
535102expand doesn't support multibyte characters (utf-8)coreutilsLowTriagedexpand.c.patchpatch
533758Button order/position should be part of ThememetacityWishlistTriaged12_add_theme_button_layout.patchpatch
533758Button order/position should be part of ThememetacityWishlistTriagedpatch.diffdiff
533200Window title misaligned in RTL languagesmetacityUndecidedNewright_left_background.patchpatch
531866tooltips on window list should be changed or removedlibwnckLowTriagedPatch to make Window List only display tooltips if task name is ellipsizedpatch
531758dput HTTP(S) auth fails with stack trace on 2.6.4-0ubuntu1 (karmic) and 0.9.5.1ubuntu1 (lucid)dputUndecidedNew* Patch fixing HTTP(S) auth for recent python releases (lucid version)patch
531758dput HTTP(S) auth fails with stack trace on 2.6.4-0ubuntu1 (karmic) and 0.9.5.1ubuntu1 (lucid)dputUndecidedNewPatch fixing HTTP(S) auth for recent python releases.patch
531719Eclipse crashes using content assist with libcairo2 1.8.10eclipseUndecidedTriagedeclipse_3.5.2-2ubuntu4.3.patchpatch
531491Switch "Shut Down" to "Switch Off" and "Suspend" to "Sleep"gnome-power-managerUndecidedTriagedgpm.patchpatch
531491Switch "Shut Down" to "Switch Off" and "Suspend" to "Sleep"gnome-power-managerUndecidedTriagedgpm3.patchpatch
531190upower (devkit-power) reporting bad data when AC cable is unpluggedupowerHighConfirmedpatch for natty version (upower0.9.8-1build1)c
531190upower (devkit-power) reporting bad data when AC cable is unpluggedupowerHighConfirmedupower patch for lucidc
531085linux-backports-modules-nouveau should replace nouveau-kernel-sourcelinux-backports-modules-2.6.32UndecidedNew0001-Add-Conflicts-Replaces-on-nouveau-kernel-source-to-e.patchpatch
531085linux-backports-modules-nouveau should replace nouveau-kernel-sourcelinux-backports-modules-2.6.32UndecidedNewAnd fix Vcs-Git harder, while I'm at it.patch
530569hal-disable-polling crash: buffer overflow detectedhalMediumConfirmedWorkarounddiff
530051Autofs and semiautomatic credentialsautofs5WishlistConfirmedautofscred.patchpatch
530051Autofs and semiautomatic credentialsautofs5WishlistConfirmedimprovement to autofs to include configurable options per hostpatch
529897Please add avahi support to others deb proxiessquid-deb-proxyWishlistConfirmeddeb-proxy.diffdiff
529714rhythmbox crashed with SIGSEGV in _nss_wins_gethostbyname_r()eglibcLowTriagedDebdiff against samba 2:3.5.8_dfsg-1ubuntu2.1patch
529714rhythmbox crashed with SIGSEGV in _nss_wins_gethostbyname_r()eglibcLowTriageddebdiff-debuglevel.patchpatch
528600error in //Adjust for border radius codejqueryUndecidedNew0001-Add-the-ability-to-query-the-command-and-control-por.patchpatch
528567Ubuntu One Music Store pluginexaileWishlistTriagedubuntuonemusicstore.diffdiff
528567Ubuntu One Music Store pluginexaileWishlistTriagedubuntuonemusicstore2.diffdiff
528567Ubuntu One Music Store pluginexaileWishlistTriagedubuntuonemusicstore3.diffdiff
528567Ubuntu One Music Store pluginexaileWishlistTriagedumusicstore.diffdiff
528328dpkg installation progress statussmartUndecidedNewsmart-dpkg-status.diffdiff
528131weather applet loses connectivity permanentlyawn-extrasUndecidedConfirmedProof of concept for checking NM before trying urlopenpatch
527564minimize to notify areagstmWishlistConfirmedclose-and-minimize.patchpatch
526845Rhythmbox Context Pane Plugin lacks internationalizationrhythmboxLowTriagedRB context Pane, i18n patchpy
525940sre_constants.error: unexpected end of pattern on smart searchsmartUndecidedConfirmedsmart-query-refactor.diffdiff
525075Please merge maximus (0.4.14-1) from Debian TestingmaximusUndecidedNewmergediff
523851Use F11 to toggle fullscreenhornseyUndecidedNewhornsey-f11.debdiffdebdiff
522438makedumpfile won't dump 2.6.31 kernelsmakedumpfileUndecidedNewUpdate LATEST_VERSION #define in makedumpfile.hpatch
522191setsockopt SOL_IPV6-level constants (IPV6_*) missing from Socket6libsocket6-perlMediumTriagedpatch adding the SOL_IPV6-level constantsdiff
521967support for new atheros wifi chipset - AR2427/ath9klinux-backports-modules-2.6.32MediumTriaged0001-ath9k-backport-support-for-new-atheros-AR2427-wifi-c.patchpatch
521677/usr/bin/rename.ul not in rename alternatives listutil-linuxWishlistTriagedutil-linux_2.16-1ubuntu6.diffdiff
521161'Z' should not be escaped in URL:stwinkleUndecidedNewFix list of unescaped characters in user, password and headers of URI :sdiff
521029Open terminal menu shortcut becomes invalid when a folder is selectednautilus-open-terminalUndecidedNewopenterminal_patch.diffdiff
520919Cantor is missing possibility to add R backendkdeeduWishlistTriagedpatch from kdeedu_4.4.1-0ubuntu2 (v.2)debdiff
520872dbconfig-common: mysqldump must dump routines during upgrade, or risk data lossdbconfig-commonMediumTriagedPatch against dbconfig-common.git enabling mysqldump including routinespatch
520546Alt-f2 switches to virtual terminal 2console-cyrillicUndecidedConfirmedpatch to /usr/bin/cyr that fixes the bugpatch
519075Eqonomize crashes on startupeqonomizeUndecidedConfirmedThe re-Compiled Versiondeb
518120dvd+rw-tools and custom layer break not workingdvd+rw-toolsUndecidedNewpatch from http://stephane.emisfr.info/tag/use-the-force-luke/patch
517887Grub Text Color w/ Splash Imagegrub2UndecidedNew05_debian_theme-menu_color.patchpatch
517574Please backport agent/mibgroup/host/hr_swrun.c to 5.4.1net-snmpWishlistConfirmedProposed fixdiff
517574Please backport agent/mibgroup/host/hr_swrun.c to 5.4.1net-snmpWishlistConfirmedhr_swrun-5.4.4-backport.patchpatch
517323Long time delay from ck-get-x11-server-pid with remote DISPLAYconsolekitUndecidedConfirmedReturn early when remote DISPLAY variable setpatch
516834bad default swappiness for desktop systemslinuxUndecidedConfirmedPatch to add Kconfig option for default swapinesspatch
514303tlf crashes on hitting ENTERtlfUndecidedConfirmedtlf-fix.patchpatch
513837socklist in procinfo does not list tcp6, udp6, or raw6.procinfoUndecidedNewsocklist patch for tcp6, udp6, and raw6.socklist-patch
513494Cross Site Request Forgery.dokuwikiUndecidedConfirmeddebdiff for karmicdebdiff
513493Information Leakage and Privilege Escalation.dokuwikiUndecidedConfirmeddebdiff for karmicdebdiff
513414memtest86+ crashes on system with > 32 e820 entriesmemtest86+UndecidedNewpatch to increase max # of e820 entries to 64diff
513077gvfsd-gphoto2 unmount leaves camera in a bad stategvfsLowTriagedinfinite invalid transaction id loop workaroundpatch
512283package texmacs-common 1:1.0.7.2-1 failed to install/upgrade: subprocess installed post-installation script returned error exit status 1texmacsUndecidedNewtexmacs-common.postinst.diffdiff
512251[Lucid Xubuntu] lshw corrupt lastmountpointlshwMediumConfirmedlshw-corrupt-last-mountpoint-fix.patchpatch
512142pktcdvd module missingudftoolsUndecidedConfirmedFix search failure for pktcdvd in /proc/miscdiff
511743typo in ntpdate manpage (patch included)ntpLowTriagedFix small typo in ntpdate manpagediff
511347set up script copies files to site-packages folder even under Python 2.6openerp-serverWishlistTriagedChange copy location if Python version is above 2.6patch
510613look(1) can't open bigfilesbsdmainutilsUndecidedConfirmedAllow "look" to work on large files on 64bit machines.diff
510613look(1) can't open bigfilesbsdmainutilsUndecidedConfirmedEnable look to handle large filesdiff
510613look(1) can't open bigfilesbsdmainutilsUndecidedConfirmedlook.diffdiff
509609grub2 support for guests >= karmicvm-builderWishlistTriagedInitial work by cjwatsonpatch
509384ubuntu-logo does not implement display_question callbackplymouthWishlistTriagedimplemented question callbackscript
508938power management not enabled with iwlagn modulelaptop-mode-toolsUndecidedNewwireless-iwl-power.patchpatch
508790language translation is bad on ubuntu 9.10nautilus-open-terminalLowTriagedAdd quilt, and a patch with an updated .po filedebdiff
507728man page missing for slapo-nssovopenldapWishlistConfirmedslapo-nssov.55
507455telnetd: deadlock on cleanupnetkit-telnetUndecidedNewPatch to fix the cleanup deadlockpatch
507132eyeD3 doesn't parse certain id3 tagseyed3UndecidedConfirmedfix-unexplained-ascii-codec-conversion.patchpatch
507132eyeD3 doesn't parse certain id3 tagseyed3UndecidedConfirmedfixes the format conversion of the description tag in printed messagespatch
507004Manual postinstalation step required for zoneminderzoneminderUndecidedConfirmedModified postinst and postrmpatch
506885Allow user to upload a crash file to a certain bugapportLowTriagedapport-collect.diffdiff
506445[patch] Lenovo Thinkpad T61, x61: FN + F5 does not enable or disable the internal wwanacpi-supportMediumConfirmedibm-wireless-8states.patchpatch
506445[patch] Lenovo Thinkpad T61, x61: FN + F5 does not enable or disable the internal wwanacpi-supportMediumConfirmedibm-wireless.patchpatch
505727No mention of howto disable keyboard shortcuts in helpgnome-terminalLowTriagedgnome-terminal.xml.diffdiff
505494Mouse events fail frequently and unpredictably, requiring kwin restartxserver-xorg-input-evdevUndecidedConfirmedPatch for chaging input-methos. http://cgit.freedesktop.org/xorg/xserver/patch/?id=1884db430a5680e37e94726dff46686e2218d525patch
505420Won't compile if build is remote called (wrong path setting in ubuntu/omnibook/Makefile)linuxMediumTriagedThat's an example of fixing that bugpatch
505391upstart config for polipopolipoUndecidedNewUpstart config for polipoconf
504959Horizontal scrolling bar of theme SphereCrystal not correctly displayedgnome-themes-moreUndecidedNewworkaround.tgztgz
504405Ctrl-Tab should jump to the next tabempathyWishlistTriagedCtrl+Tab, Ctrl+Shift+Tab key_press_event handler PATCHtxt
504381[K8M800] Xubuntu does not display properly on Lucid alpha-1 with updates, on Averatec 3280xserver-xorg-video-openchromeLowConfirmedk8m800_newmode.patchpatch
503509xulrunner debug symbols are not usablexulrunner-1.9.1UndecidedNewPatch switches xulrunner packaging to VPATH builddiff
503193screen locking hacks no longer requiredcasperWishlistNewpatch for scripts/casper-bottom/[10adduser|22gnome_panel_data]patch
503138Lucid & Natty, KVM, After kernel message hrtimer: interrupt too slow.... the SMP kvm guest becomes slow.kvmMediumConfirmedsecond hrtimer patch found addressing this issuepatch
503003multiple entries in fstab with same mount-pointmountallMediumTriagedmountall-fstab.patchpatch
502316Trivial C-program which includes Python.h does not compile cleanlypython-defaultsWishlistTriagedpatch.txttxt
502177gigantic memory leakcurlftpfsUndecidedConfirmedpatch against 0.9.2 which fixes the leakpatch
501630qct not able to perform file operations (e.g. diff) within svn repositoriesqctUndecidedConfirmedqct_svn_status_columns.diffdiff
501426When printing a calendar, the font size is too smallevolutionLowTriagedIncreases font size97_increase_calendar_week_font
500262Errors if file name contains escaped special characters (space, parenthesis etc)chm2pdfUndecidedConfirmedpatch which will convert the previous chm filediff
499483/etc/default/grub cannot disable use of UUIDgrub2UndecidedConfirmedgrub-mkconfig_lib.patchpatch
499162Man-page plugin is hardcoded to yelpgnome-do-pluginsUndecidedNewpatch to replace yelp with xdg-openpatch
498921avelsieve can't connect dovecotes managesieveavelsieveUndecidedNewpatch-managesieve.lib.phpphp
498288Speakup failes to compile, and needs this 1-line fixspeakupUndecidedNewThis is the one-line fix for this bug.diff
497904Support Application Indicatorsconnman-gnomeLowIn ProgressSupport for app indicatorpatch
497790squid should provide an apparmor profilesquidWishlistTriagedadds apparmor profile and installationpatch
496422cachefilesd not starting with CONFIG_CACHEFILES=ycachefilesdUndecidedNewpatch to /etc/init.d/cachefilesdtxt
496256Nokia CS-15 USB modem does not work anymore and can not be installed in Karmicnetwork-managerUndecidedConfirmed25-nokia-zerocd.rulesrules
495695[PATCH] Only allow ascii characters in oem-config password fieldsuser-setupUndecidedNewubiquity_2.0.10netbook2.debdiffdebdiff
494803Non-RAW images and NTFS aren't properly detected in partition2diskeucalyptusMediumTriagedPatch to gracefully ignore Qcow-formatted images.patch
494803Non-RAW images and NTFS aren't properly detected in partition2diskeucalyptusMediumTriagedpartition2disk-ntfs.patchpatch
494616Antique clock face shows 4 as IV rather than IIII .cairo-clockUndecidedNewtheme files for "antique" with correct representation of the value 4.7z
494223jack alsa driver unable to initialize capture-only modejack-audio-connection-kitLowTriagedJosh Green's patch ported to apply against jack1patch
492995Howmany option from grub no longer available in grub2grub2WishlistTriaged10_linux.patchpatch
492995Howmany option from grub no longer available in grub2grub2WishlistTriagedgrub-mkconfig.patchpatch
492995Howmany option from grub no longer available in grub2grub2WishlistTriagedgrub.patchpatch
492658Rhythmbox MusicBrainz cover art search engine fails to load available cover artrhythmboxLowIn Progressadd a missing sub method that allows the MusicBrainz search handler to return resultspatch
491864Please update fsvs to fsvs-1.2.1fsvsWishlistNewfsvs_1.2.2-1ppa~maverick4.diff.gzgz
491623ndiff crashes when its called with not nmap filesnmapLowConfirmedndiff.patchpatch
491352Patch for incorrect charset in notification emailssudoUndecidedConfirmedPatch to include charset info in sudo notification emailspatch
491352Patch for incorrect charset in notification emailssudoUndecidedConfirmedPatch to use ctime in sudopatch
490799A rejected reinvite remains pending causing all further reinvites to be rejectedtwinkleUndecidedNewA patch to let rejected reinvites completepatch
490210/usr/share/mk/bsd.own.mk sets the OBJECT_FMT variable incorrectlypmakeUndecidedNewSuggested fix to txt
490008initramfs-tools hook script should not complain to stdouttuxonice-useruiUndecidedNewtuxonice_userui.diffdiff
490002Haier CE100 CDMA EVDO modem not listed in 10-modem.fdihal-infoUndecidedNewHAIER CE100 Patch for 10-modem.fdipatch
489830Settings of gpointing-device-settings are non-persistentgpointing-device-settingsUndecidedConfirmedsavesettings.diffdiff
489830Settings of gpointing-device-settings are non-persistentgpointing-device-settingsUndecidedConfirmedscrollsliders_direction.diffdiff
489719portblock resource agent script is broken and will not work.heartbeatUndecidedNewportblock.patchpatch
489136patch: makes adduser.conf a symlink to a profile (provides switchable profile feature to all frontends)adduserWishlistTriagedinitial patch to support adduser profilespatch
488740gpsdrive-scripts : version for gpsfetchmapgpsdriveUndecidedNewgpsfetchmap diffdiff
487922Crashes all the time on ArrayIndexOutOfBoundsException in libgcj.so.10gcj-4.4UndecidedNewdebian's workaround patchignore_locale
487168hdparm fails to handle security configuration...hdparmUndecidedConfirmedpartial fix for issues reporteddiff
486922synergys interfering with gnome panel window list synergyUndecidedConfirmedHack for synergy to ignore expanded edge panel childspatch
486922synergys interfering with gnome panel window list synergyUndecidedConfirmedgtk+2.0-2.18.5-1 patchtxt
486716Can't search database if a command is on PATHcommand-not-foundWishlistConfirmedAdd command packages-providing; Detect x86_64patch
486303Every illegal character aren't well detected and forbiddenhuginUndecidedConfirmedpatch_forbidden_character.diffdiff
486154System beep broken in Karmic despite heroic efforts to fix itmetacityMediumTriagedKeep metacity from grabbing audible system bell events.debdiff
485844finch - debug text frequently dumped to screenpidgin-libnotifyUndecidedConfirmedPatch to existing indicate.patch to comment out g_debug callspatch
485681Cannot shutdown, when more than one desktop user is createdfast-user-switch-appletUndecidedNewPatch of /usr/share/polkit-1/actions/org.freedesktop.consolekit.policypatch
485225Won't link when using ftglGetLayoutBBoxftglUndecidedConfirmedProposed fixpatch
484753movixmaker-2 fails as can't find iso.sortmovixmaker-2UndecidedNewmkmovixiso.patchpatch
484336/etc/rsyslog.conf permissions incorrect/missing for creation of dynamic filesrsyslogUndecidedConfirmedProposed patch for rsyslog.confpatch
484317GDM allows root loginsgdmMediumTriaged26_disallow_rootlogin.patchpatch
484317GDM allows root loginsgdmMediumTriaged29_disallow_invalid_login.patchpatch
484317GDM allows root loginsgdmMediumTriageddisallow_root_login.patchpatch
484317GDM allows root loginsgdmMediumTriagedrevision2patch
484252Format action wipes all partitionsusb-creatorHighTriagedFix for gtk-frontenddiff
484252Format action wipes all partitionsusb-creatorHighTriagedusb-creator.patchpatch
483833lsof manpage is garbled (exceptions section is too narrow)lsofUndecidedConfirmedPatch to manual filedagdiff
483130If 'startx' is run from within a text console, ConsoleKit session is not marked 'active'consolekitUndecidedConfirmedPatch for 90consolekitpatch
482255tuxonice userui is not workingtuxonice-useruiUndecidedIn Progressdebdiff to add fade_logo call and pm-utils hookdebdiff
482255tuxonice userui is not workingtuxonice-useruiUndecidedIn Progresspatch for pm-utils' 98-smart-kernel-videopatch
482255tuxonice userui is not workingtuxonice-useruiUndecidedIn Progresspatch to add fade_logo callspatch
482255tuxonice userui is not workingtuxonice-useruiUndecidedIn Progresstuxonice-userui_1.0-1ubuntu0.1.debdiffdebdiff
481556dispwin: ../../src/xcb_io.c:542: _XRead: Assertion `dpy->xcb->reply_data != ((void *)0)' failed.argyllUndecidedNewPatch to solve the problempatch
481498Gears do not work in prismgearsUndecidedConfirmedugly workaround for lucid (firefox 3.6)patch
480600Xchat-Gnome's menus in nonstandard orderxchat-gnomeLowIn Progressview_menu.patchpatch
479810GTK+ / WACOM / XINERAMA: Incorrect offset makes Wacom unusablegtk+2.0LowTriagedPatch that repairs well known existing bug in GTK+patch
479405--bwlimit option uses KiB/s, but is documented as (what amounts to) kB/srsyncLowTriagedA patch to change the documentation to use "KiB/s" and "kibibytes per second".diff
479343Alcatel X060/X200 broadband modems do not work in karmicmodemmanagerUndecidedNewPatch to fix problem number 4 abovepatch
478551Unresolvable host breaks clustersshclustersshUndecidedNewFix from upstream 3.27patch
477333cron job is overly noisysysstatWishlistConfirmedsysstat-karmic.diffdiff
476429forum mail not processed due to wrong use of html2text APImoodleUndecidedNewbug fixdiff
476384PKCS#12 Certificate file and passphrase sent by email are unusablenewpki-serverUndecidedNewnewpki-server_emails.patchpatch
476208casper booting from nfsroot doesn't respect nfs filesystem options correctlycasperMediumNewfix handling of nfsopts boot parameter forpatch
475891[SRU] eagle crashes on several user actionseagleMediumNew475891fix.diffdiff
475891[SRU] eagle crashes on several user actionseagleMediumNewcrash_one_zoom.debdiffdebdiff
475891[SRU] eagle crashes on several user actionseagleMediumNewfixoldbinaryinhome.debdiffdebdiff
475355Choppy sound on Vortex 2 under KarmicpulseaudioUndecidedNewPatch which call pa_alsa_dump when alsa-sink ans alsa-source underrunpatch
475249NewPKI Client can't load a PKCS#12 certificate to connect to the PKI.newpki-clientUndecidedNewdebian_package_wx2.6_pkcs12_file.patchpatch
475249NewPKI Client can't load a PKCS#12 certificate to connect to the PKI.newpki-clientUndecidedNewwx2.6_pkcs12_file.patchpatch
474906Closing Xchat-gnome should "hide" the window, like with empathyxchat-indicatorWishlistConfirmedxchat-gnome-close-event.patchpatch
474906Closing Xchat-gnome should "hide" the window, like with empathyxchat-indicatorWishlistConfirmedxchat-indicator-hide-on-close.patchpatch
472697Automatically switch to new devices when connectedpulseaudioWishlistTriagedswitch-on-connect.debdiffdebdiff
472234update-manager-core DistUpgrade/utils.py does not honour http_proxy env variableupdate-managerWishlistTriagedPatch to add support for using the http_proxy environment variable in DistUpgrade.utils.init_proxy()diff
470824spurious trailing space after tab completionbash-completionUndecidedNewdebdiff of changes present in branchdebdiff
469572Exaile <-> Music applet communication does not workmusic-appletUndecidedIn ProgressFixed "/usr/share/python-support/music-applet/musicapplet/plugins/exaile.py" filepy
469568Grub2's chainloader cannot load extlinux (syslinux)grub2HighTriagedFix chainloader's reporting of partition informationdiff
467825Battery state always "fully charged"upowerMediumConfirmedSuggested patchpatch
467825Battery state always "fully charged"upowerMediumConfirmednever-disable-polling-0-9-1.patchpatch
467000insserv doesn't work with upstartinsservMediumTriagedAdds lsb-header to upstart-jobpatch
467000insserv doesn't work with upstartinsservMediumTriagedupstart-job.patchpatch
467000insserv doesn't work with upstartupstartUndecidedConfirmedAdds lsb-header to upstart-jobpatch
467000insserv doesn't work with upstartupstartUndecidedConfirmedupstart-job.patchpatch
466074Undecorates new windows with undecorate disabledmaximusUndecidedNewmaximus-0.4.14_undecoratepatch.diffdiff
464088Buffer overflow in Idb__HDR_GetHeader() (with fix)openmotifUndecidedNewAnd here's a fixdiff
463562libvirt-bin Karmic upgrade fails when invalid users exist in /etc/groupadduserLowConfirmedoutout
463471karmic regression: logcheck prints CRON CMD linesrsyslogWishlistConfirmedProposed debdiffdebdiff
463015Both fat and ext[234] boot sectors present at once cause confusione2fsprogsUndecidedNewnew-patchnew-patch
463015Both fat and ext[234] boot sectors present at once cause confusiongrub2UndecidedNewnew-patchnew-patch
461987Enable testsuite (and fix resulting failures)antlr3MediumTriagedantlrtest.diffdiff
461885vuurmuur initscript errorvuurmuurUndecidedNewpatch for the vuurmuur.init filediff
461432sloccount doesn't recognize .[ch]++ files as cppsloccountUndecidedNewpatch to add ".c++" and ".h++" file suffix support.patch
461096ZTE AC8700 modem doesn't workmodemmanagerUndecidedConfirmedmm-sid.patchpatch
460729Typo in fdupes manpagefdupesLowTriagedfdupes_1.50-PR2-3ubuntu1.debdiffdebdiff
460483The plugin should allow Evolution to close to the indicator-appletevolution-indicatorWishlistTriagedevolution-indicator.c.diffdiff
460483The plugin should allow Evolution to close to the indicator-appletevolution-indicatorWishlistTriagedevolution-indicator_0.2.8.patchpatch
460483The plugin should allow Evolution to close to the indicator-appletevolution-indicatorWishlistTriagedevolution_2.28.3.patchpatch
460380Logo/Throbber Positions PatchxsplashWishlistTriagedxsplash.c and diff includedgz
460365Create a separate license document and include it in all documentsubuntu-docsWishlistConfirmedpatch on ubuntu-docs bzr branchdiff
459730rsyslog doesn't create /dev/xconsole rsyslogUndecidedConfirmedxconsole.debdiffdebdiff
459716encrypted modes don't work on ndiswrapper wireless adaptersndiswrapperUndecidedConfirmediw_ndis.c.diffdiff
458077manpage case fixopenjpegUndecidedNew0001-fixed-manpage-by-upcasing-K-of-cinema2K-and-cinema4K.patchpatch
458027when using dual screen, the ubuntu screen doesn't appear on the main screen but on the most left screen. However, the user choice screen appear effectively on the main screen.xsplashWishlistTriagedbug458027.diffdiff
454807Display Settings Panel Icon should have Detect Monitors entrygnome-settings-daemonWishlistTriagedDetect Monitorspatch
454789Internal microphone on Vaio VGN-TT160N does not workalsa-driverUndecidedConfirmedPatch for stock kernel 2.6.34diff
454215wmctrl doesn't adjust position of terminal windows in HardywmctrlUndecidedNewsnap any window to left or right of the screen, make it half width and full heightsh
453807nm_vpn_connection_connect_cb(): VPN connection 'xyz' failed to connect: 'No VPN secrets!'.network-manager-openvpnUndecidedConfirmedAdditional patch, allows user at the console to start an openVPN connectionpatch
453807nm_vpn_connection_connect_cb(): VPN connection 'xyz' failed to connect: 'No VPN secrets!'.network-manager-openvpnUndecidedConfirmedChecks for valid secrets only on PASSWORD_* connection typespatch
453747Wrong folder size on folder in smb sharessambaLowTriagedPatch which fixes the problempatch
453610When using srm recursively, a 'too many files open' error occurs.secure-deleteMediumTriagedPatch for srm.cdiff
452940Don't clear the screen when switching to the alternate screenvteLowTriagedTrivial fixdif
452907[PM800] No terminal (Ctrl+Alt+F1, ...) after suspend to RAM (cunfused screen now)xserver-xorg-video-openchromeLowTriagedForce MMX YUV42X copypatch
452907[PM800] No terminal (Ctrl+Alt+F1, ...) after suspend to RAM (cunfused screen now)xserver-xorg-video-openchromeLowTriagednewmodePm800.patchpatch
452907[PM800] No terminal (Ctrl+Alt+F1, ...) after suspend to RAM (cunfused screen now)xserver-xorg-video-openchromeLowTriagedopenchrome-0.2.904-set_colorkey_for_2nd_monitor.patchpatch
452907[PM800] No terminal (Ctrl+Alt+F1, ...) after suspend to RAM (cunfused screen now)xserver-xorg-video-openchromeLowTriagedpm800_usevbe.patchpatch
450645error during slapd configuration: chown: cannot access `olcDbDirectory\nolcDbDirectory'openldapLowConfirmedrestrict "grep" searches to files with names ending in ".ldif"patch
449198No GUI option to change login themegdmMediumTriagedPatch from upstream bug trackerpatch
448710doesn't let you combine exit on close and toggle on clickrhythmboxWishlistConfirmedMake status-icon-mode 2 have the behavior of Jaunty Rhythmboxpatch
448710doesn't let you combine exit on close and toggle on clickrhythmboxWishlistConfirmedMinimize to Tray Checkboxpatch
448665Running ensymble gives TypeError: import_module() takes at most 5 arguments (6 given)ensymbleUndecidedConfirmedStill need to change dependenciespatch
447295Reprofile when /lib/modules is updatedureadaheadWishlistTriaged/etc/cron.daily/sreadaheadsreadahead
447295Reprofile when /lib/modules is updatedureadaheadWishlistTriagedpatch for /var/lib/dpkg/info/sreadahead.triggersdiff
446703init script is missing LSB informationtpbWishlistTriagedtpb.diffdiff
444167nabi is not visible in notification areanabiUndecidedConfirmedbug patchdiff
443406evolution-dev should depend on libgtkhtml3.14-dev and libebook1.2-devevolutionLowTriageddebdiff, take 2diff
443406evolution-dev should depend on libgtkhtml3.14-dev and libebook1.2-devevolutionLowTriagedevo-dev-dependencies.diffdiff
443358No Mouse-Button Reverse Option for Touchpadsgnome-settings-daemonWishlistConfirmedtap button configuration via gconf-editorpatch
443333vino system service icon fully couloredhumanity-icon-themeWishlistTriagedpanel-icon.patchpatch
443333vino system service icon fully couloredvinoLowTriagedpanel-icon.patchpatch
443080ecryptfs mount does not support -f (fake mount)ecryptfs-utilsWishlistTriagedoutout
441518Missing /usr/lib/ruby/1.8/i486-linux/_augeas.solibaugeas-rubyUndecidedNewlibaugeas-ruby.fix-pkg-tools-ruby-removal.debdiffdebdiff
440983libmltmotion_est.so missingmltUndecidedConfirmedre-enable motion_est modulepatch
440613bzr support for rancidrancidUndecidedTriagedpatch against the most recent packagediff
440237Copy of ID3 tag V2 to v1 behavior not consistent in tagtooltagtoolUndecidedNewMy solutionpatch
437749Ubuntu should ship wine with the wine-pulse patcheswine1.2UndecidedConfirmedwinepulse-0.30.patchpatch
437749Ubuntu should ship wine with the wine-pulse patcheswine1.2UndecidedConfirmedwinepulse-0.31-configure.ac.patchpatch
437749Ubuntu should ship wine with the wine-pulse patcheswine1.2UndecidedConfirmedwinepulse-winecfg-0.6.patchpatch
437733set has-frame of option comboboxes to falsegdmWishlistTriagedset has-frame to false for option comboboxpatch
437314SGR handling is brokenboglUndecidedNewPatch to fix SGR handling for up to 10 parametersdiff
436962 not rendered correctly in exported PDFinkscapeLowTriagedBUG436962_symbolassymbol.diffdiff
436962 not rendered correctly in exported PDFinkscapeLowTriagedbetter fill rule handlingdiff
436962 not rendered correctly in exported PDFinkscapeLowTriagedrendering symbol element as symbol not groupdiff
436887Log out, shutdown and reboot confirmation alerts don't follow GNOME HIGindicator-sessionLowTriagedUpdated patch, adding mnemonics for "Restart Instead" buttonsdiff
436887Log out, shutdown and reboot confirmation alerts don't follow GNOME HIGindicator-sessionLowTriagedindicator-session-HIG.diffdiff
435935Support Upstartgnome-system-toolsUndecidedTriagedgnome-system-tools_2.29.91-0ubuntu3.debdiffdebdiff
435719gvfs-fuse fails to start on NFS mounted homesgvfsLowTriaged51gvfs-fuse-on-nfs51gvfs-fuse-on-nfs
435543Default Gnometris block theme is uglygnome-gamesWishlistTriageddebdiff for removal of patch 80debdiff
434529Support for baudrate > 115200gtktermUndecidedNewpatchpatch
434177[K8M800]cant setup 1024x800 screen no VGA detectedxserver-xorg-video-openchromeLowConfirmedmode_set.patchpatch
433808Patch to add a fuzzy clockgnome-panelWishlistTriagedgnome-panel-2.24.1-0ubuntu2.1-fuzzy-clock.diffdiff
433799core R package in universe nags me to install proprietary software at every start-upr-baseWishlistTriagedbug433799.diffdiff
433545at command ignores savings time when given UTC timeatMediumTriagedPatch from the bug open to Debiandiff
432785add support to ecryptfs-setup-swap for keyed hibernationecryptfs-utilsWishlistConfirmedkeyed-swap.patchpatch
432785add support to ecryptfs-setup-swap for keyed hibernationubiquityWishlistConfirmedkeyed-swap.patchpatch
431259Request for inclusion of libneethi_utilaxis2cUndecidedNewPatch for including neethi_utilpatch
431251Incorrect SOAP fault handling when Rampart is engagedaxis2cUndecidedNewPatch by François Mireauxpatch
428651There's no notification for status changingpidgin-libnotifyWishlistConfirmed0001-add-notifications-for-idle-and-status-changes.-lp-bu.patchpatch
428619[cs46xx] Need tweaks to daemon.conf to eliminate crackle/distortionpulseaudioUndecidedNewrevert svolume_mmx.c back to last known good versionpatch
428443There should be a way to hide the menu in os-probergrub2UndecidedConfirmedos-prober.patchpatch
427822UTC should be "no" when installing under VirtualBoxubiquityUndecidedNewpatch-for-ext3patch-for-ext3
427775ntpdate.dhcp always ignoredntpWishlistTriageddhcp.patchpatch
425892netcat CRLF supportnetcatMediumTriagedPatch and changelog for netcat containing CRLF optiongz
424927include CK patch set (BFS)linuxWishlistConfirmeddarxus's rename/abi patch, updated for the lucid kerneldiff
424927include CK patch set (BFS)linuxWishlistConfirmedlinux-rename.diffdiff
423778DarkRoom active window caption is unreadable in Human colorshuman-themeLowTriagedA patch to disable text shadingpatch
423616casper boot doesn't work with some boot optionscasperMediumNewpatch for casper for support of boot option live-mediapatch_casper
423252NSS using LDAP+SSL breaks setuid applications like su, sudo, apache2 suexec, and atdlibgcrypt11MediumConfirmedpotential gnutls fixtxt
423252NSS using LDAP+SSL breaks setuid applications like su, sudo, apache2 suexec, and atdlibgcrypt11MediumConfirmedpotential libgcrypt fixtxt
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2gtk+2.0LowTriaged099_slider_trough_border.patchpatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2gtk+2.0LowTriagedAlternative patch for Gtk2patch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2gtk+2.0LowTriagedProof of concept patch for Murrinepatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2gtk+2.0LowTriagedProper murrine patchpatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2gtk+2.0LowTriagedgtkrc.patchpatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2human-themeLowConfirmed099_slider_trough_border.patchpatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2human-themeLowConfirmedAlternative patch for Gtk2patch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2human-themeLowConfirmedProof of concept patch for Murrinepatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2human-themeLowConfirmedProper murrine patchpatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2human-themeLowConfirmedgtkrc.patchpatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2seamonkeyUndecidedNew099_slider_trough_border.patchpatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2seamonkeyUndecidedNewAlternative patch for Gtk2patch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2seamonkeyUndecidedNewProof of concept patch for Murrinepatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2seamonkeyUndecidedNewProper murrine patchpatch
422511problem with new scrollbar in Human theme - GtkRange::trough-border set to 2seamonkeyUndecidedNewgtkrc.patchpatch
422298dash interpreter don't handle some unicode characters correctlydashUndecidedConfirmeddash-double-unescape.patchpatch
422220smartdimmer doesn't increase brightnessnvclockUndecidedNewnvclock_0.8b4-smartdimmer.diffdiff
421338fgfs-atlas FTBFS and needs to be updated for plib transitionfgfs-atlasHighConfirmedpartial fixpartial
420967grub2 does not allow to disable memtest optionsmemtest86+UndecidedConfirmedPatch to introduce GRUB_DISABLE_MEMTEST86 option to /etc/default/grubdiff
420683gdk-update-viewer UnicodeDecodeErrorpackagekit-gnomeUndecidedConfirmedbackend.py.diffdiff
419299make fai softupdate quietfaiWishlistNewquiet_patchpatch
419143Printing from evince (and perhaps other GTK apps) to PostScript printers is broken ("0a" bytes inserted into PostScript output)cairoHighTriageddebdiff for the karmic updatedebdiff
419143Printing from evince (and perhaps other GTK apps) to PostScript printers is broken ("0a" bytes inserted into PostScript output)popplerUndecidedTriageddebdiff for the karmic updatedebdiff
419082couchdb fails to start with xulrunner-1.9, needs xulrunner-1.9.1couchdbUndecidedConfirmedcouchdb_0.10.0~svn802936-0jh3_0.10.0~svn802936-0jh4.diff.gzgz
417757[regression] all network apps / browsers suffer from multi-second delays by default due to IPv6 DNS lookupseglibcHighTriagedMake NSPR use AI_ADDRCONFIG if requested by callerpatch
417757[regression] all network apps / browsers suffer from multi-second delays by default due to IPv6 DNS lookupseglibcHighTriagedMake getaddrinfo() ignore IPv6 link-locals for AI_ADDRCONFIGpatch
416150[enhancement] change default portiputilsUndecidedNewjust changes the default port number from 44444 to 33434patch
416058Cannot raise windows from Java (toFront) - meta_window_same_application improvementmetacityLowTriagedPatch adapted for 2.22patch
415805sulogin on serialsysvinitUndecidedNewpatch to /etc/event.d/suloginpatch
414865mount.cifs does not handle umlauts in usernames correctlygnome-vfsUndecidedNewgnome-vfs-ignore-cifs.patchpatch
414560ath9k disassociates/reassociates a lotlinux-backports-modules-2.6.31HighConfirmed75_ath9k-1005ha-reload75_ath9k-1005ha-reload
414560ath9k disassociates/reassociates a lotlinux-backports-modules-2.6.31HighConfirmedPatch to add config options to disable powersave for wlanpatch
414560ath9k disassociates/reassociates a lotlinux-backports-modules-2.6.31HighConfirmedPatch to disable rfkill in ath9kpatch
414189package doesn't provide init scriptsmbnetfsUndecidedNewinit scriptsmbnetfs
412975option to hide handles on non-expanded panelgnome-panelWishlistTriagedfixed patchdiff
411703Ufraw does not process Canon EOS 500D RAW files correctly.libkdcrawUndecidedConfirmedUpdate for dcraw.cc and dcraw.hdiff
411390Translations: po-python.pot template is missing, existing .po files uselessgimpLowConfirmedAdd another intltool-update call to rulespatch
411045slapd cannot get resinstalled or removed if the configuration files were lostopenldapLowTriagedslapd-init-script-fix.diffdiff
411023Updated Brazilian Portuguese translation for synapticsynapticMediumTriagedsynaptic-0.62.7ubuntu2/po/pt_BR.popo
410929ValueError: min() arg is an empty sequencemutagenUndecidedNewmid3iconv.patchpatch
409060cpqarrayd crashes while checking for controllerscpqarraydLowTriagedPatch that made my problem go away.debdiff
408392prename directoy fixperlUndecidedNewperl-prename-strip-directory.patchpatch
407875Kindle 2 HAL supporthal-infoUndecidedConfirmedAdd Kindle 2 to usb media players for HALtxt
407875Kindle 2 HAL supporthal-infoUndecidedConfirmedOops forgot the music directory parttxt
407344pdf printing on karmic fails: pdftopdf crashed on signal 11lcmsUndecidedNewdebdiff to fix this and three other bugs in Karmicdebdiff
407344pdf printing on karmic fails: pdftopdf crashed on signal 11lcmsUndecidedNewdebdiff to fix this and two other bugs in Karmicdebdiff
406702rtkit requires a kernel patchlinux-rtUndecidedConfirmedsched-introduce-SCHED_RESET_ON_FORK-scheduling-policy-flag.patchpatch
406544hotssh should depend on hotwirehotsshUndecidedNewAdd hotwire to Depends:patch
405576Leafpad clean up GTK IncludeleafpadUndecidedNewRemove use of GTK+ deprecated symbolspatch
404296init.d/mongrel-cluster doesn't follow Ubuntu startup stylemongrel-clusterUndecidedNewmongrel-cluster style patchdiff
404295mongrel_cluster_ctl doesn't support --quiet, doesn't print errors to STDERRmongrel-clusterUndecidedNewPatch to add -q/--quiet and send errors to stderr.diff
404026notify-osd launch assumes GDMnotify-osdLowTriagednotify-osd-kdm.diffdiff
403767{upstream} madam: no devices found for /dev/md0mdadmUndecidedNewpatchpatch
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)alltrayLowConfirmed"Fix" for VLC 1.0.xpatch
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)alltrayLowConfirmedcommented source code (and binary for 10.04 32bits) that work for the default theme of Lucidgz
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)amsnLowConfirmed"Fix" for VLC 1.0.xpatch
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)amsnLowConfirmedcommented source code (and binary for 10.04 32bits) that work for the default theme of Lucidgz
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)checkgmailLowConfirmed"Fix" for VLC 1.0.xpatch
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)checkgmailLowConfirmedcommented source code (and binary for 10.04 32bits) that work for the default theme of Lucidgz
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)gajimUndecidedConfirmed"Fix" for VLC 1.0.xpatch
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)gajimUndecidedConfirmedcommented source code (and binary for 10.04 32bits) that work for the default theme of Lucidgz
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)gnome-panelLowConfirmed"Fix" for VLC 1.0.xpatch
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)gnome-panelLowConfirmedcommented source code (and binary for 10.04 32bits) that work for the default theme of Lucidgz
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)gxneurUndecidedConfirmed"Fix" for VLC 1.0.xpatch
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)gxneurUndecidedConfirmedcommented source code (and binary for 10.04 32bits) that work for the default theme of Lucidgz
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)wine1.2LowTriaged"Fix" for VLC 1.0.xpatch
403135Notification area icon wrongly rendered/uses bg_color as a background (multiple apps)wine1.2LowTriagedcommented source code (and binary for 10.04 32bits) that work for the default theme of Lucidgz
401915only shows flag with question marks on it [patch included]fbxkbUndecidedNewpatch that fixes itpatch
401817Disable Thumbnailers in accessible installcasperMediumTriagedthumbnailers.patchpatch
400429Ralink (rt73) support for Edimax W-7318USgrt73UndecidedNewAdd support for Edimax W-7318USgdiff
400277Use XML Catalogs in saxonb-xsltsaxonbWishlistNewProposed new script that includes conditional XML catalog resolutionsaxonb-xslt
400259Bogus SystemID in XHTML catalog makes org.apache.xml.resolver failw3c-dtd-xhtmlWishlistNewThis patch applied to /usr/share/xml/xhtml/schema/dtd/*/catalog.xml should fix the problemdiff
399484Can't auto-expand all subfolders in Nautilus tree view.nautilusUndecidedConfirmedHalf hearted patch to add expand "all"patch
399422spambayes issues a sets-related DeprecationWarning from classifier.py:43spambayesUndecidedConfirmedkiko v1: make Set import conditional399422-v1
399259Deprecated warnings around "import md5" when importing pyro or starting the pyro-nsd daemonpyroUndecidedNewFirst go at a patch - fixes for 2.6 anyway.patch
399259Deprecated warnings around "import md5" when importing pyro or starting the pyro-nsd daemonpyroUndecidedNewUses ImportError to fall back.patch
398790Seahorse embeds filename "-&25"seahorseLowTriagedadds an embedded filename when encrypting using seahorsegz
398790Seahorse embeds filename "-&25"seahorseLowTriagedupdate to prior patchgz
398057slime-gather-lisp-implementations generates incorrect data structureslimeUndecidedNewgather.patchpatch
397808The Notify-OSD log should save at least one copynotify-osdWishlistTriagedattempt to backup log file prior to openingpatch
397564wall message should use HH:MM:SS in printing the time, to avoid ambiguityutil-linuxMediumTriagedoutout
396605Bad CHARSET in filenames of zip archives, created with ubuntup7zipUndecidedConfirmedp7zip-9.20.1-manual-iconv-lc_dos.patchpatch
396605Bad CHARSET in filenames of zip archives, created with ubuntuzipUndecidedConfirmedp7zip-9.20.1-manual-iconv-lc_dos.patchpatch
396578lastfmsubmitd uses deprecated md5 modulelastfmsubmitdUndecidedConfirmedlastfmsubmitd.patchpatch
396025psnup ignores "-p" optionpsutilsUndecidedConfirmedpsutils-add-papersize.diffdiff
394642merged duplicate strings to reduce # of msgstrsgnome-app-installMediumTriagedmerged duplicate strings to reduce # of msgstrsdiff
394432Notify-osd & XFCEnotify-osdLowTriagedDiff between trunk r373 and my branchdiff
394432Notify-osd & XFCEnotify-osdLowTriagedsupport_for_xfconf.patchpatch
394398Logic to determine expected number of running session wrong (regression in hardy's open-iscsi 2.0.865-1ubuntu3.1)open-iscsiHighConfirmedopen-iscsi_2.0.865-1ubuntu3.4.debdiffdebdiff
393364copyfs asks for fuse-module even when fuse is compiled in the kernelcopyfsUndecidedNewcopyfs-fuse.patchpatch
393138contact list oddities with xmonadempathyLowTriagedempathy-2.30.2-ubuntu-bug393138.patchpatch
393138contact list oddities with xmonadxmonadUndecidedNewempathy-2.30.2-ubuntu-bug393138.patchpatch
392869Duplicate entries with Alcatel X060 (and possibly other) broadband modemsnetwork-managerLowTriagedFixes duplicate entries of Alcatel 3G modemspatch
392175Implement gnome-terminal activity monitor featuregnome-terminalWishlistTriaged02_notifications.patchpatch
392122"dim display when idle" only dims but doesn't restore the previous value when not idle anymoregnome-power-managerLowConfirmed0001-Added-call-to-gpm_brightness_evaluate_and_set-into.patchpatch
391623apport hook for EvolutionevolutionWishlistTriagedthe Evolution apport hookpy
391623apport hook for EvolutionevolutionWishlistTriagedthe apport report downloaderpy
391623apport hook for EvolutionevolutionWishlistTriagedthe hack to download all reports with backtracespy
391622initramfs-tools uses dhcp even with a static ip address in comand linecasperMediumNewreplace DEVICE with IPOPTSpatch
391622initramfs-tools uses dhcp even with a static ip address in comand linelive-initramfsMediumTriagedreplace DEVICE with IPOPTSpatch
391111HARDY : samhain cannot start because init script doesn't create "/var/run/samhain/" directorysamhainUndecidedNewadds PID file support to /etc/init.d/samhainpatch
391092Problem with ax_boost_unit_test_framework.m4autoconf-archiveUndecidedNewdereference-link.patchpatch
390880pidgin-encryption: Plugin details website is outdatedpidgin-encryptionUndecidedNewA patch to fix the problempatch
390744should have icons for 'Sign' and 'Encrypt...' in nautilus context extensionseahorse-pluginsWishlistTriagedaddicons.diffdiff
390730mdb-export prints binary for OLE fields.mdbtoolsUndecidedConfirmedPatch against mdb-export.c.diff
390508notifyOSD ignores the expire timeout parameternotify-osdWishlistConfirmedPatch for using timeout from notify-sendpatch
390488gpm manual errors: 8.2 & 8.6gnome-power-managerLowTriagedlow_or_critical_help.patchpatch
389614Rdesktop crashes when removing USB key with LTSPrdesktopMediumTriagedDo not call rewinddir(pdir) if pdir is zero.patch
388904Nautilus 'Computer' displays redundant labelsgvfsLowTriagedpatchpatch
388607Smart should show key id for signed channel if it doesn't find the keysmartUndecidedNewsmart-nokey.diffdiff
388456[PM800] When running applications in full screen mode, Wine crashes X when quitting applicationxserver-xorg-video-openchromeLowConfirmedmodesetting.patchpatch
388456[PM800] When running applications in full screen mode, Wine crashes X when quitting applicationxserver-xorg-video-openchromeLowConfirmedpatchpatch
388303Eye of Gnome should have Image Collection enabled by defaulteogWishlistConfirmedeog_2.27.90-0ubuntu2.debdiffdebdiff
387963pam_auth: ALERT - canary mismatch on efree() - heap overflow detectedphp-auth-pamUndecidedNewphp-auth-pam_0.4-10.patchpatch
387816cannot parse for more than one -O/-o options; cannot use -i optionpsshWishlistConfirmedmore than 1 -O options passed; -I (identity) options addeddiff
387816cannot parse for more than one -O/-o options; cannot use -i optionpsshWishlistConfirmedtransfer from remote to local directiondiff
386893Searching within a notebook should inform the user that no results were found within that notebooktomboyWishlistIn Progressdebdiff for the bug-386893 of Tomboydebdiff
386740[K8M800] virtual size does not correctly set on panelxserver-xorg-video-openchromeLowTriageddebug patch for openchrome SVN 751patch
386740[K8M800] virtual size does not correctly set on panelxserver-xorg-video-openchromeLowTriagedopenchrome-debug-cursor-position.patchpatch
386740[K8M800] virtual size does not correctly set on panelxserver-xorg-video-openchromeLowTriagedopenchrome-debug-cursor-position2.patchpatch
386740[K8M800] virtual size does not correctly set on panelxserver-xorg-video-openchromeLowTriagedopenchrome-debug-xy.patchpatch
386740[K8M800] virtual size does not correctly set on panelxserver-xorg-video-openchromeLowTriagedopenchrome_add_debug_checkpoints.patchpatch
386740[K8M800] virtual size does not correctly set on panelxserver-xorg-video-openchromeLowTriagedopenchrome_debug4.patchpatch
386740[K8M800] virtual size does not correctly set on panelxserver-xorg-video-openchromeLowTriagedsetstartingaddress2.patchpatch
386740[K8M800] virtual size does not correctly set on panelxserver-xorg-video-openchromeLowTriagedstartingaddress.patchpatch
386125Wine submenu aren't translated in the app menuwine1.2MediumTriagedPatch to add Hungarian translations for menu itemspatch
386125Wine submenu aren't translated in the app menuwine1.2MediumTriagedbrazilian portuguese language patch for Winepatch
386125Wine submenu aren't translated in the app menuwine1.2MediumTriagedbrazilian portuguese language patch for Winetxt
386125Wine submenu aren't translated in the app menuwine1.2MediumTriageditalian menu patchitalian-menu-translation
386125Wine submenu aren't translated in the app menuwine1.2MediumTriagedspanish-menu-translation.txttxt
386125Wine submenu aren't translated in the app menuwine1.2MediumTriagedtranslate-wine-menu-entries-el.patchpatch
386125Wine submenu aren't translated in the app menuwine1.2MediumTriagedtranslate-wine-menu-entries-nl.patchpatch
386125Wine submenu aren't translated in the app menuwine1.2MediumTriagedtranslate-wine-menu-entries-ru.patchpatch
385889Hibernate and Suspend actions should appear in GshutdowngshutdownUndecidedNewpatch which adds Hibernate and Suspend actions, use dbus org.freedesktop.ConsoleKit + other improvements to Gpoweroffgz
385423Handle interfaces configured by DHCPucarpUndecidedTriageducarp.patch.txttxt
385417libqt3-mt segfault on closing sql databaseqt-x11-freeUndecidedNewqt3-mysql-unload-crash.diffdiff
384914Buffer overflow in uw-mailtutils cause by extra-long passwordsuw-imapUndecidedNewThe attached patch fixes the buffer overflowpatch
383974Invalid use of assert() around expressions with required side-effects (i.e., getcontext())wvstreamsUndecidedNewPatch to prevent setcontext calls from being compiled out if assertions are removed during build.diff
383875add convenience function "notify_has_server_cap" to notify.hlibnotifyWishlistTriagedlibnotify_server_caps_convenience.patchpatch
383875add convenience function "notify_has_server_cap" to notify.hlibnotifyWishlistTriagednot-proper debdiff (no patchsystem used) for testingdebdiff
383875add convenience function "notify_has_server_cap" to notify.hlibnotifyWishlistTriagedwith strcmp and NULL check (after hickups)patch
383263[Lenovo IdeaPad Y430] Subwoofer don't mute/unmute on plugging external acousticsalsa-driverUndecidedConfirmedPatch for Linux 2.6.32patch
382832Need comment for line added to /etc/ldap.conf by nssldap-update-ignoreusers(8)libnss-ldapWishlistTriagedAdds an explanatory commentdiff
382134kexec-tools fails to configure installed kernelkexec-toolsUndecidedConfirmedDebdiff to fix issuedebdiff
381882Implement Arabic shaping in winewine1.3LowTriagedwine_1.0.1-0ubuntu6_1.0.1-0ubuntu7.debdiffdebdiff
381829NSSOV and Samba groupsopenldapLowTriagednssov_groups_with_spacenssov_groups_with_space
381490xdg-user-dirs has no man pages; URL in README is incorrectxdg-user-dirsLowTriagedxdg-user-dirs_0.11-0ubuntu3.patchpatch
381438Problem with sox call in cs_helpers.pycapisuiteUndecidedConfirmedFix sox call.patch
381384mod_deflate with mod_fastcgi gives wrong content-length headerlibapache-mod-fastcgiMediumTriagedChanges for Content-Lengthpatch
381384mod_deflate with mod_fastcgi gives wrong content-length headerlibapache-mod-fastcgiMediumTriagedChanges in SNAP-0811090952patch
381326User-set buddy icons are not displayed on notify-osd popupspidgin-libnotifyUndecidedNewcustom_icons.patchpatch
381089Cleanup launcher and UI for desktop-switcherdesktop-switcherWishlistTriagedPatch providing all changes suggesteddiff
380925bootlogs.sh usage message incorrectly mentions bootmisc.shsysvinitUndecidedNewreplace "bootmisc.sh" with "bootlogs.sh"debdiff
380663open-iscsi initiator tries to resolve ipv6 address of target and failsopen-iscsiUndecidedNewopen-iscsi-try-all-target-addresses.patchpatch
380144xcdroast+wodim can't setup (1st run as root)xcdroastUndecidedConfirmedquick hack to "make it work"patch
379318Unusable on Ubuntu Hardy when /tmp is not writablelibapache-mod-evasiveUndecidedConfirmedMoves LOGDIR from /tmp to /var/cache/apache2, fixing the fault.patch
379233cp preserves mode with --no-preserve=modecoreutilsUndecidedConfirmedcp-umask-mode.patchpatch
378639firstlogin script can't be executed because the permission of /root directory is 0700 in the virtual machine created by python-vm-builder vm-builderLowTriagedOverride the firstloginrc itself when first-login suceeded.patch
378639firstlogin script can't be executed because the permission of /root directory is 0700 in the virtual machine created by python-vm-builder vm-builderLowTriagedfirstlogin.patchpatch
378547--components argument does not resolve dependencies properlydebootstrapUndecidedNewSearch through all components for dependenciespatch
378390ssc-ffmpeg.so plugin fails to loadmt-daapdUndecidedNewpatched ssc-ffmpeg pluginpatched
378248Video editing docs need workubuntu-docsLowNewVideo_editing_capture.diffdiff
378235undefined symbol in pd-csoundcsoundUndecidedConfirmed2009-nowl.patchpatch
378235undefined symbol in pd-csoundcsoundUndecidedConfirmedcsound.patchpatch
378033[P4M900] X.org detects bad resolution (720x400 instead of 1680x1050)xserver-xorg-video-openchromeLowConfirmedMSI-P4M900M3-L.patchpatch
377636Maximum value of rain delay is set to highcompizconfig-settings-managerUndecidedNew/usr/share/compiz/water.xmlxml
377466dh-make-pear fails to make Debian package upon WARNINGdh-make-phpUndecidedNewdh-make-pear can extract the package from downloaded packages, even if the download causes a warningpatch
377367gnome-terminal doesn't handle colons in URLsgnome-terminalLowTriagedgnome-terminal.patchpatch
376929receiving error "Server returned empty response to SUBSCRIBE request"pidgin-librvpUndecidedNewrvp.c.patch from http://anil.net.in/blog/?p=89patch
376859CCCC crashed on AMD64ccccUndecidedNewcccc.patchpatch
376110Changing the Calendar of an existing recursive schedule hides all entries except the first oneevolutionLowTriageddebdiff for the stable bug fix changedebdiff
375982output wrong, uses sky instead of matching texturegimp-resynthesizerUndecidedNewFull text of patched script.scm
375098[hardy] libdkim-dev missinglibdkimUndecidedConfirmedLP375098.diffdiff
375038XPS file format not supportedevinceWishlistTriagedenable_xps.debdiffdebdiff
374868HAL entry for iRiver E50hal-infoUndecidedNewPatch to add support for the iRiver E50patch
374283drscheme doesn't appear it the Applications/Programming menuplt-schemeLowTriagedAdd .desktop file for DrSchemepatch
374241Won't generate new certificates due to "can't use string as ARRAY ref" errortinycaUndecidedNewGUI.patchpatch
374216cannot startedpureadminUndecidedNewpatch moves g_thread_init to the proper location.patch
374090[VX800] Samsung NC20 installation problem(viafb problem)module-init-toolsUndecidedNewFix bug with suspend and VT switch on VX800 chipset and 64bit systemsdiff
374090[VX800] Samsung NC20 installation problem(viafb problem)module-init-toolsUndecidedNewdisable_lines.patchpatch
374090[VX800] Samsung NC20 installation problem(viafb problem)xserver-xorg-video-openchromeHighTriagedFix bug with suspend and VT switch on VX800 chipset and 64bit systemsdiff
374090[VX800] Samsung NC20 installation problem(viafb problem)xserver-xorg-video-openchromeHighTriageddisable_lines.patchpatch
372833Pidgin doesn't show all MSN smileys using msn-pecan protocolpidginWishlistConfirmeddebdiffdebdiff
372815Only 20 updates per feed when using google-synclifereaWishlistConfirmedHardcode limit to 500 instead of default 20patch
371943[Netmonitor] Netmonitors screenlets doesn't display wlan0 trafficscreenletsLowTriaged20-netmonitor-new-version.patchpatch
371903sysvinit: correctly wait for backgrounded tasks with CONCURRENCY=shellsysvinitUndecidedNewfix: wait for all the backgrounded init scripts with the same sequence number before executing the next bunch of scriptsdebdiff
371720_tkinter.TclError: unknown color name "{#c3c3c3}"tixMediumConfirmedDiff file for building Tixgz
371595parted crashes with "double free or corruption" messagepartedUndecidedNewPatch used for compiling upstream version of parted with gcc4 for reference.patch
371002Brasero reports incorrect drive speedbraseroLowConfirmedbrasero-pre.pngpng
370839kiki should depend on python-wxgtk2.6 or python-wxgtk2.8, not just on python-wxgtk2.6speUndecidedConfirmedkiki_0.5.6-3.1ubuntu1.9.04.debdiffdebdiff
370839kiki should depend on python-wxgtk2.6 or python-wxgtk2.8, not just on python-wxgtk2.6speUndecidedConfirmedkiki_0.5.6-3.1ubuntu2.debdiffdebdiff
370778Axioo CMPC display stays blank after resume from suspendhal-infoUndecidedNewaxioo-cmpc-s2r.patchpatch
370742Repeating keys for compro DVB-T200 inputlinux-ports-metaUndecidedNewcompro_patchcompro_patch
370617Dell Latitude C600 backlight remains on in S3 suspendhal-infoUndecidedNewenable dpms_suspend quirk for Dell C600patch
370617Dell Latitude C600 backlight remains on in S3 suspendhal-infoUndecidedNewhal-info_20091130-1ubuntu1.debdiffdebdiff
370539Errors in Xubuntu-docsxubuntu-docsLowTriagedChanges to the first half of the Xubuntu Docsbz2
370061SVG not correctly renderedlibrsvgLowTriagedFix for .coord (.6 instead of 0.6) handlingpatch
369993Traceroute in Network Tools not functioninggnome-nettoolLowTriagedadds -l 1000 to tracepathpatch
369942[PATCH] fix session actions on Fedora's gdm 2.26netbook-launcherUndecidedNewReplaces GDM calls with gnome-power-cmd.sh and gnome-session-savepatch
369942[PATCH] fix session actions on Fedora's gdm 2.26netbook-launcherUndecidedNewUse stock icons to replace Human-only iconspatch
369735sendEmail with tls fails to authenticate on some servers (ie. postfix)sendemailUndecidedNewPatch against sendEmail 1.55, fix authentificationpatch
369522obexpushd and obexftp not correctly restarted after S3/S4gnome-user-shareLowTriaged14_fix_session_race.patchpatch
36949832bits gtk and glib modules not found in ia32-libsglib2.0MediumTriaged99_gio-host-modules.patchpatch
36949832bits gtk and glib modules not found in ia32-libsglib2.0MediumTriagedglib patch for packagepatch
36949832bits gtk and glib modules not found in ia32-libsglib2.0MediumTriagedglib patch forwardedpatch
36949832bits gtk and glib modules not found in ia32-libsglib2.0MediumTriagedgtk patch - forwardedpatch
368787DeprecationWarning: the sha module is deprecated; use the hashlib module insteadapt-p2pLowTriagedDHT.py.diffdiff
368325Option iCon 225 (HSDPA USB stick) cannot connect (Jaunty Jackalope 9.04)mobile-broadband-provider-infoLowConfirmedhso patch 1patch
368292qprof sends wrong values to addr2line on amd64qprofUndecidedNewa one line fix that works on my systempatch
368127ToME Crashes RandomlytomeUndecidedConfirmedtome-savefix.patchpatch
368044slapd crash when using SQL backendopenldapLowTriagedpossible fixdiff
367871-u flag has no functionfortune-modLowTriagedSimple diffpart1-diff
367871-u flag has no functionfortune-modLowTriagedThis one is the right one, the other is the full edited manpagepatch
367671PulseAudio gets killed mysteriously on RT kernelslinux-rtUndecidedConfirmedsoft RLIMIT_RTTIME lower than hard limitpatch
366881Network driver atl1e malfunctioninglinux-ports-metaUndecidedNewDriver provided on bundled CD with ASUS motherboardbz2
366343in initramfs-tools scripts/init-top/framebuffer: "mode" parameter should be "mode_option" for drivers using modedbinitramfs-toolsUndecidedNewPatch to change "mode" module parameter to "mode_option"patch
365436simfs is a local file systemtigerUndecidedNewLocal fix adding simfs to gen_mountsgen_mounts
365399other "open file" dialogd4xUndecidedNewpatch to apply new dialogpatch_d4x
364986trickle enhancement: scheduled bandwidth shapingtrickleWishlistTriagedpatch from vanilla source of trickle 1.07gz
364986trickle enhancement: scheduled bandwidth shapingtrickleWishlistTriagedpatch of my changes from the 1.07-5 sourcegz
364699[PATCH] IR doesn`t work (lirc_igorplugusb)lircUndecidedConfirmedFix buffer overrun issues.LP364699-fix-buffer-overrun
364699[PATCH] IR doesn`t work (lirc_igorplugusb)lircUndecidedConfirmedfix for too small bufferLP364699-fix-igor
364699[PATCH] IR doesn`t work (lirc_igorplugusb)lircUndecidedConfirmedfix karmicLP364699-fix-buffer-overrun
364688Tcpick uses wrong timestamps in the output tcpickUndecidedNewtcpick-0.2.1.patchpatch
364292Warning icon with no warning message on partitioner screenubiquityLowTriagedgtk_gui.diffdiff
364186Documentation is not XHTMLpycurlUndecidedConfirmedPatch to fix callbacks.html and curlshareobject.htmld
363619Language-support-extra-de breaks OpenOffice spell checker in Jauntylanguage-support-extra-deUndecidedConfirmedaffix file for the de_med Hunspell dictionaryaff
363619Language-support-extra-de breaks OpenOffice spell checker in Jauntylanguage-support-extra-deUndecidedConfirmedhunspell-de-med_20100204-2_all.debdeb
362812Kerry does not work correctly on thunderbird imap messageskerryUndecidedNewFix kerry integration with Thunderbirdpatch
362500Mouseemu swallows events for extended keyboard keys, e.g. multimedia keysmouseemuUndecidedConfirmedNot all keyboards have EV_REP set so ignore itdpatch
361988[Hewlett-Packard HP EliteBook 2530p] suspend/resume failurelinuxUndecidedIn ProgressPatch to enable proper suspend to RAM of 2530ppatch
361865twisted does not update its plugin cache properly in jauntypython-axiomUndecidedNewtwisted-web-361865.debdiffdebdiff
361865twisted does not update its plugin cache properly in jauntytwisted-calendarserverUndecidedNewtwisted-web-361865.debdiffdebdiff
361733dmraid(fakeRAID) raid1 driver doesn't loadbalance readslinuxUndecidedConfirmedraid1-loadbalance.patchpatch
361667Very bloated SVG in notification iconshuman-icon-themeUndecidedNewIcon bloat fixesgz
361230[partner] Please use po-debconfacroreadWishlistTriageddebdiffdebdiff
360883The xtrlock mouse cursor should be upgradedxtrlockLowNewxtrlock.patchpatch
360129Add support for openchrome xvmc-vld in mplayermplayerWishlistConfirmedmplayer-1.0-rc2-XvMC_VLD.diffdiff
359963Apport retracing service is incorrectly interpreting installed version: None as being out of dateapportLowConfirmedcheckNONE.patchpatch
359857blt does not work as currently packagedbltUndecidedNewblt patch for pixmap/render crashes6-patch
359857blt does not work as currently packagedbltUndecidedNewblt patch for zoomstackpatch
359177Strange or obsolete code in mysql initscriptmysql-dfsg-5.0LowConfirmedPatch for the mysql-server-5.0 init script.patch
358650Copy addresses from mailto: linksmidoriWishlistNewmailto.diffdiff
358145QtReactor bug, unable to remove WRITE handleraceUndecidedNewlibace-qtreactor-5.6.3_ubuntu.patchpatch
357980PS3: Handle swap on ps3vram automatically on bootsysvinitUndecidedNewexplicit mkswap and swapon in checkroot.shdebdiff
357673No notification when sliding audio volume, muting volume on ThinkPad X23, X24, X31, X32, X41, X60, T22, T40, T41, T42, T43, T43p, T60, R50e, R51, R52gnome-settings-daemonMediumTriagednotify.diffdiff
357292Netspeed applet has wrong name in Add to PanelnetspeedWishlistIn ProgressDEBDIFFDEBDIFF
357001distcc prevents mounting due to wrong home directorydistccMediumConfirmedDebdiff which solved the above problem.debdiff
357001distcc prevents mounting due to wrong home directorydistccMediumConfirmeduse-system-default-home-dir.patchpatch
356089Error in Russian translation in Hardylanguage-pack-ruUndecidedNewPatch which removes invalid translationpatch
356068various control keys become stuck in searchandrescuesearchandrescueUndecidedNewFixes stuck key bug in SARpatch
355846audacity stops recording after about a second when using software play-throughaudacityUndecidedConfirmed355846-patch2.txttxt
355081wallpaper-tray always displays pictures from /usr/share/backgroundswallpaper-trayLowConfirmedwp_tray-0.5.3-gnomewp.patchpatch
354465Jaunty and Unsupported distribution error (moblin image-creator)moblin-image-creatorUndecidedConfirmedmic_cfg.patchpatch
354136unintuitive back and forwardfile-rollerLowTriagedfile-roller-2.24.1_history-fix.diffdiff
354136unintuitive back and forwardfile-rollerLowTriagedfile-roller-2.24.1_history-fix2.diffdiff
351429file-roller associates itself with windows executables that it can't handlefile-rollerLowTriagedRemove application/x-ms-dos-executable from file roller associationsdebdiff
351429file-roller associates itself with windows executables that it can't handlefile-rollerLowTriagedfile-roller-no-ms-dox-executables.debdiffdebdiff
351297Misplacement of the popupgmail-notifyUndecidedNewdiff between the current and the patched versiondiff
350920Rawdog isn't runnable (incompatibilities with python 2.6)rawdogUndecidedConfirmedFixed rawdog.pypy
350920Rawdog isn't runnable (incompatibilities with python 2.6)rawdogUndecidedConfirmedas.patchpatch
350920Rawdog isn't runnable (incompatibilities with python 2.6)rawdogUndecidedConfirmedas_and_hashlib.patchpatch
350920Rawdog isn't runnable (incompatibilities with python 2.6)rawdogUndecidedConfirmedhashlib.patchpatch
350351[Acer TravelMate 4000] suspend/resume failure during wakeuphalUndecidedNew/usr/share/hal/fdi/information/10freedesktop/20-video-quirk-pm-acer.fdi.patchdiff
349948Text is cut off in popup indicating safe to remove mediagnome-mountLowTriagedsmall gtk examplec
349230Wrong parsing of command line argumentssubtitleripperUndecidedNewQuick and dirty fixpatch
348546Sound Converter puts output files in the wrong folder, even overwriting filessoundconverterUndecidedIn Progressuse correct pathpatch
348377service-discovery-applet displays too many notificationsservice-discovery-appletWishlistTriagedModify service-discovery-applet to update its notifier as services are discovered, with a small gap between updatespatch
348377service-discovery-applet displays too many notificationsservice-discovery-appletWishlistTriagedModify service-discovery-applet to update its notifier as services are discovered.patch
348377service-discovery-applet displays too many notificationsservice-discovery-appletWishlistTriagedModify service-discovery-applet to use append modepatch
348353Pulseaudio fails with Alsa a52 (ac3) plugin (Ubuntu 10.04 Lucid)alsa-pluginsUndecidedConfirmedWorking version of the patch to fix and configure pulseaudio to use the A52 alsa pluginpatch
348353Pulseaudio fails with Alsa a52 (ac3) plugin (Ubuntu 10.04 Lucid)pulseaudioLowConfirmedWorking version of the patch to fix and configure pulseaudio to use the A52 alsa pluginpatch
347540user's home directory labeled incorrectly when created with useraddshadowUndecidedNewfedora11-shadow-utils-selinux.patchpatch
347368orca screen reader can't handle intuitive input when selecting languagegnome-orcaUndecidedNewa txt file containing the diff between the origional and the version containing my brief changes.txt
346474ImageMagick interprets PGM header incorrectlyimagemagickMediumTriagedSolves the bug with PNM images with maxval 256patch
346095Regression: bubble location setting from notification-daemon is not migrated to notify-osdnotify-osdWishlistConfirmedgravity options patchpatch
346072solarwinds crashed with SIGFPE in vbo_exec_vtx_flush()rss-glxMediumConfirmedmove also glBegin and glEnd inside the conditionalpatch
345918stunnel source option (-S) not supportedstunnel4LowTriagedWorkaround patch for installed packagepatch
345522Pidgin filetransfers don't generate notificationspidgin-libnotifyWishlistConfirmednotify_file_transferts.debdiffdebdiff
345520Racecondition when restarting apache2apache2-mpm-itkUndecidedNewPatch from Jan Boysen to fix racecondition.diff
345134tailor crash by the migration from a git to bzr repository on Ubuntu 8.04 HardytailorUndecidedNewchangeset_r1454.diffdiff
344163Default config uses bad check_mail setting.multitailUndecidedNewAvoid excessive wakeups when check_mail has non-zero value and mail_spool_file is not setpatch
343870php-cli segmentation fault with mysql extensionmysql-dfsg-5.0MediumConfirmedPatch to remove unneeded changes to Linux threading.dpatch
343707Rhythmbox tries to find a codec for a m3u/html filerhythmboxLowTriagedrhythmbox_0.12.0-0ubuntu5.debdiffdebdiff
343200launcher properties dialog appearance is wrong with human-netbook-themehuman-netbook-themeLowConfirmedhuman-netbook-theme-fix-black-bg-on-panel-editor.patchpatch
342541AtomicParsley crashes reading fragmented .ismv MP4satomicparsleyUndecidedNewcheck for atom overflowdiff
342541AtomicParsley crashes reading fragmented .ismv MP4satomicparsleyUndecidedNewpatchpatch
342451aufs fails for certain packagesupdate-managerMediumTriaged(verbose) proof of concept patch how to workaround the problemdebdiff
342347irman usb timeoutlibirmanUndecidedNewlibirman package diffpatch
342056Samba automatic account creation assumes local accountssambaWishlistTriagedPatch for debian/samba.postinstdiff
341874xsane: WARNING: setting an adjustment with non-zero page size is deprecated.xsaneUndecidedConfirmedDebdiff against 0.995-3ubuntu2.debdiff
341704galrey creates tags with empty height and width attributes in index filesgalreyUndecidedNewPatch for galrey's thumbnail image tagspatch
340970When apport complains package is outdated, it doesn't let you updateapportWishlistIn ProgressA possible patch for the problemdiff
340873modprobe requires .conf filenames since JauntyisdnutilsUndecidedNewpostinst.patchpatch
340873modprobe requires .conf filenames since JauntyisdnutilsUndecidedNewpostinst2.patchpatch
340873modprobe requires .conf filenames since JauntyndiswrapperLowConfirmedpostinst.patchpatch
340873modprobe requires .conf filenames since JauntyndiswrapperLowConfirmedpostinst2.patchpatch
340639interception of system() and option to set dynmic linkerfakechrootUndecidedNewPatch described abovepatch_fakeroot2
340526Building failure on LPIAgaucheUndecidedIn ProgressA patch to configure.ac for Hardypatch
340526Building failure on LPIAgaucheUndecidedIn ProgressA patch to configure.ac for Intrepidpatch
340309jscalibrator display two times the same joystick devicelibjswUndecidedNew30_device_path.dpatchdpatch
340285Alacarte should avoid retaining unneeded files in ~/.local/share/applicationsalacarteWishlistTriagedAdds a function checkDuplicatepatch-MenuEditor
340213[jaunty] Use indicator-applet for new messagesgajimWishlistConfirmed340213.debdiffdebdiff
340020Logcheck rule for dovecot does not ignore valid Maildir mailboxeslogcheckUndecidedNewAllow '&', '#', and ' ' in mailbox names to be passed by the logcheck dovecot filterdiff
338661Use hashlib instead of md5planetLowTriageddiffdiff
338563kernel update fails when kernels from other distributions are installed in shared /bootinitramfs-toolsMediumConfirmedproposed fixdebdiff
338442bug reports would benefit from an apport hookfoomatic-guiUndecidedNewsystem-config-printer_1.1.3+git20090218-0ubuntu5.debdiffdebdiff
338217scim-bridge crashed with SIGSEGV in scim::Module::unload() - fixed by "rm -Rf ~/.scim/"scim-bridgeMediumConfirmedLP338217.debdiffdebdiff
337109Error loading HumanCircle GDM themeubuntu-gdm-themesUndecidedConfirmedhumancircle-image-links.diffdiff
336270gnome-app-install takes too many clicks to install codecsgnome-app-installUndecidedNewReduce number of clicks required to install codecsdiff
335853DVB-T MUX Frequency list for my city (it-Verona-Zevio)kaffeineUndecidedNewit-Verona-Zevioit-Verona-Zevio
335851DVB-T MUX Frequency list for my city (it-Verona-Zevio)linuxtv-dvb-appsUndecidedNewit-Verona-Zevioit-Verona-Zevio
335821Reoccurring events aren't working completelyical2sqliteUndecidedNewsolves the reoccuring event problempatch
335666libc6 integration gives way wrong error message to libc5 binaries.command-not-foundWishlistConfirmedReturn ENOEXEC instead of ENOENT if an ELF binary's interpreter doesn't exist.patch
335643xdg-utils incorrectly parses output, causing wrong outputxdg-utilsLowTriagedFixes bugs and creates test.patch
335383Add ability to change notify-osd font sizenotify-osdWishlistTriagedDiff between trunk r373 and my branchdiff
335383Add ability to change notify-osd font sizenotify-osdWishlistTriagedPatchdiff
334809design problem? infinite wait for long queuemail-notificationUndecidedConfirmedxchat-gnome-notify-osd-append-hint.diffdiff
334809design problem? infinite wait for long queuenotify-osdWishlistConfirmedxchat-gnome-notify-osd-append-hint.diffdiff
333909The error appears if to use --no-ok key, dialog return incorrect code.dialogMediumConfirmedbug_fix.patchpatch
332628synergy server hangs with Flash pages and OperasynergyUndecidedNewfixflashhang.patchpatch
332332mpd won't properly install untill localhost changed to 127.0.0.1 in /etc/mpd.confmpdMediumTriagedmpd_0.14.2-3ubuntu2~quadrispro1.debdiffdebdiff
331048dell bluetooth switch not completely supportedhalUndecidedNewhal_dell_fix.debdiffdebdiff
331002grub crashes setting up a EXT2_GOOD_OLD_REV filesystemgrubUndecidedNewCorrected ext3_256byte_inode.diffdiff
330682[wishlist] Build with sound supportnotification-daemonWishlistNewdebdiff against notification-daemon_0.4.0-0ubuntu2.dscdebdiff
329540Blackberry Utils Timing out on JauntybarryUndecidedTriagedbarry.8330.patchpatch
329540Blackberry Utils Timing out on JauntybarryUndecidedTriagedokeefe_0.15.patchpatch
329519gnomecatalog cannot deal with filenames including #gnomecatalogUndecidedNewBugfix patch to reader.pydiff
329389"Party mode" ununderstandable and undocumentedrhythmboxLowTriagedPatch for documentation filediff
329330gkrellm crashes upon start with "floating point exception"gkrellmUndecidedNewbug fixdiff
328089splashy 0.3.13-3ubuntu1 fresh install conflicts with lsb-basesplashyHighTriagedsplashy_0.3.13-3ubuntu2.debdiffdebdiff
327963Error activating XKB configuration with MacBook keyboard modelxkeyboard-configMediumConfirmedAdd aliases for mac layoutsdiff
327846does not use input output directory properlylatex2rtfUndecidedTriagedbug-327846.patchpatch
327003add transparency to panel run dialog.gnome-panelWishlistTriagedgnome-panel_2.25.90-0ubuntu2.debdiffdebdiff
326258gconf-editor - Ugly Key Type Iconsgconf-editorWishlistConfirmedgconf-editor_2.24.1-2ubuntu3.debdiffdebdiff
325932Add ability to change "hosts" in /etc/nsswitch.confauth-client-configWishlistTriagedPatch to enable hostnames from LDAP in auth-client-configpatch
325932Add ability to change "hosts" in /etc/nsswitch.confauth-client-configWishlistTriagedPatch to enable modification of hosts in nssswitch.conf through auth-client-configpatch
325932Add ability to change "hosts" in /etc/nsswitch.confauth-client-configWishlistTriagedWorking patchpatch
325315Flushing Cache notification too verbosegnome-mountLowTriagedProposed patchdiff
325059missing init scriptspacenavdUndecidedNewsetup_init.patchpatch
324364Options table contains duplicate OptionKey rowstrackerUndecidedTriagedProposed for Hardy (not compiled or tested yet)patch
324360new backend: rar archive support (patch)gvfsWishlistTriagedthe rarfs backend, applies directly to gvfs treepatch
324233Network Manager 0.7 doesn't use resolvconf to remove nameserver info if it didn't use resolvconf for adding its nameserver info - wipes /etc/resolv.conf linknetwork-managerMediumTriagedIf /etc/resolv.conf is a symlink, then follow it.txt
324233Network Manager 0.7 doesn't use resolvconf to remove nameserver info if it didn't use resolvconf for adding its nameserver info - wipes /etc/resolv.conf linknetwork-managerMediumTriagedIgnore resolv.conf symlinktxt
324233Network Manager 0.7 doesn't use resolvconf to remove nameserver info if it didn't use resolvconf for adding its nameserver info - wipes /etc/resolv.conf linknetwork-managerMediumTriagedlp324233.patchpatch
324233Network Manager 0.7 doesn't use resolvconf to remove nameserver info if it didn't use resolvconf for adding its nameserver info - wipes /etc/resolv.conf linknetwork-managerMediumTriagednm-correct-resolvconf-handling.patchpatch
323363Sub Models field are not saved if we a new after modificationopenerp-clientUndecidedNewpatch to resolve the problemdiff
322327Integrated permissions/ownership diff output for etckeeper/bzrbzrWishlistTriagedbzr.diffdiff
322327Integrated permissions/ownership diff output for etckeeper/bzretckeeperWishlistTriagedbzr.diffdiff
322231[PATCH] Incorrect apt-dater instructions in /usr/share/doc/apt-dater/READMEapt-daterUndecidedNewPatch against /usr/share/doc/apt-dater/README (fixes incorrect ssh-copy-id and ssh-keygen instructions)patch
321442NM ignores "system"-level connections if files are world-readablenetwork-managerMediumTriagednetwork-manager-allow-world-readability.patchpatch
321107'chktri' script doesn't find the '??-' trigraphliwcUndecidedNewexample file to show the problem, and patch to fix the scriptdiff
320623Some problems with mount --bind -o bind syntaxbusyboxUndecidedNewSupport for double mount syntax workaroundgz
320623Some problems with mount --bind -o bind syntaxbusyboxUndecidedNewlive-initramfs Support for double mount syntax workaroundgz
320623Some problems with mount --bind -o bind syntaxinitramfs-toolsUndecidedNewSupport for double mount syntax workaroundgz
320623Some problems with mount --bind -o bind syntaxinitramfs-toolsUndecidedNewlive-initramfs Support for double mount syntax workaroundgz
320623Some problems with mount --bind -o bind syntaxlive-initramfsUndecidedNewSupport for double mount syntax workaroundgz
320623Some problems with mount --bind -o bind syntaxlive-initramfsUndecidedNewlive-initramfs Support for double mount syntax workaroundgz
320223Don't squish expandable applets when adding new onegnome-panelLowTriagedpanel-expand.debdiffdebdiff
319994nrss can't parse non-UTF-8 encoded feed that contains non-ASCII charactersnrssLowTriagedencoding.patchpatch
319994nrss can't parse non-UTF-8 encoded feed that contains non-ASCII charactersnrssLowTriagednrss_0.3.9-1ubuntu1.debdiffdebdiff
319655glade-2: WARNING: setting an adjustment with non-zero page size is deprecated.gladeLowNewDebdiff against 2.12.2-0ubuntu3.debdiff
318959Desktop-profiles doesn't export a correct XDG_CONFIG_DIRSdesktop-profilesUndecidedNewpatch i wrote to correct the file.patch
318812*** buffer overflow detected ***: xfig terminated xfigUndecidedNewFix fordpatch
318703nagios check_smtp expects integer instead of doublenagios-pluginsLowTriagedUntested patch for check_smtp12
318689gnome-system-log attempts to open bogus/inexistent logfilesgnome-utilsLowTriagedJaunty debdiffdebdiff
318689gnome-system-log attempts to open bogus/inexistent logfilesgnome-utilsLowTriagedlogview.patchpatch
318495Patches for documentationautofsWishlistConfirmedautofs.patch.bz2bz2
318459wackamole init script does not check for existence of /var/run/wackamolewackamoleUndecidedNewwackamole.patchpatch
318456amule and adunanza must coexistamule-adunanzaWishlistTriagedcohexistence-all.diffdiff
318221watch command does not show utf-8 charactersprocpsLowTriaged70_watch-unicode-3.2.8.dpatch #2dpatch
318180gnubik fails to launch; prints "cannot get suitable visual" to terminal and exitsgnubikUndecidedNewPatchedpatch
318076less volume controls after Intrepid installalsamixerguiUndecidedNewunset_pulse_internal.patchpatch
317744rbbr crashes on click at TreerbbrUndecidedNewrbbr.patchpatch
315896freeradius upgrade broken in hardy backportsfreeradiusUndecidedTriagedComments unnecessary SQL includes, and brings conf and initscripts into agreementdiff
315650xubuntu-docs, add application wrong location for menuitemxubuntu-docsUndecidedConfirmedPatch to remove the "System" submenu from the menu instructions for gnome-app-installdiff
315111netdiscover segfaults when looking up vendorsnetdiscoverUndecidedConfirmedmisc.patchpatch
315107Key Values for Documents Need to be constrained to one wordreferencerUndecidedNew0002-fixed-bug.patchpatch
315107Key Values for Documents Need to be constrained to one wordreferencerUndecidedNewapply this diff to referencer-1.1.2/src/DocumentProperties.Cdiff
314675Segfault on access to user data passed to action callbacknotify-pythonMediumTriagedPatch to property maintain 'user_data' refcountpatch
313808gPass Glade Files Major ImprovementsgpassWishlistConfirmedgpass_0.5.0-2ubuntu1.debdiffdebdiff
313040blueproximity calls the proximity command twice each intervalblueproximityUndecidedNewpatchpatch
312462document_new_from_data() arg1 must be without null bytespython-popplerUndecidedIn Progresspoppler.defs.diffdiff
312384[natty] a typo in description of "Cluster Management"system-config-clusterLowConfirmedsystem-config-cluster_1.0.46-0ubuntu5.debdiffdebdiff
312365trackerd uses O_NOATIME, but fruitlesslytrackerUndecidedNewuse O_NOATIME in an xdgmime routinepatch
312123xsane name in .desktop file is too longxsaneUndecidedConfirmedxsane_0.996-1ubuntu2.debdiffdebdiff
311847Stjerm doesn't receive focus when openedstjermUndecidedConfirmedJust call gtk_window_present instead of trying to determine whether the window is active.diff
311253btscanner crashes on try using "brute force scan"btscannerUndecidedNewFix wrong size when initializing a bt address while doing a brute-force scanpatch
311086Quarry about dialog close button doesn't workquarryUndecidedConfirmedFix for about dialog close buttonpatch
311059New feature (require a clean exit from job)anacronWishlistTriagedPatch to version 2.3-13 to implement this featurediff
311051[KM400]xserver/openchrome crash with unichromexserver-xorg-video-openchromeHighConfirmeddisable_dri.patchpatch
311029curl and pycurl is not compiled with sftp supportcurlLowTriagedAdds libssh2-1-dev as a build-dependency for curl to enable sftp supportdiff
311029curl and pycurl is not compiled with sftp supportcurlLowTriagedcurl-ssh.patchpatch
311029curl and pycurl is not compiled with sftp supportcurlLowTriagedcurl-with-ssh.patchpatch
310998Gnus: nnimap doesn't work with MS Exchange 2007emacs22UndecidedNewPatch to add MS-Exchange compatibility to Gnus' IMAP/nnimap modulespatch
310861APT-proxy fails on single download errorapt-mirrorWishlistConfirmedTrivial patch to warn and continue if a source is absentpatch
310264can't add photo to usergiverLowTriagedgiver-0.1.8-photoButtonFix.patchpatch
310259cron job should not run if gnu locate is not selected alternativefindutilsUndecidedNewcron.daily/locate: check if we are selected alternative and abort if notp
310078Canon XT doesn't work with Kubuntu 8.10 in PTP or normal modelibgphoto2UndecidedNewkamera.patchpatch
309913Basilisk2 does not create a menu entry (altough creates a file in /usr/share/menu)basilisk2WishlistTriagedbasilisk2_0.9.20070407-4ubuntu1.debdiffdebdiff
309803gwhois depends on inetdgwhoisUndecidedConfirmedgwhois_20081227ubuntu1.debdiffdebdiff
309792rxvt-unicode: Excessive font spacingrxvt-unicodeUndecidedConfirmedadd letterSpace optionpatch
309364Allow to specify message typesendxmppUndecidedNewsendxmpp-1.14-add_cmdline_type.patchpatch
309362Connecting to alternative host doesn't worksendxmppUndecidedNewsendxmpp-1.14-alt_server_fix.patchpatch
309245Stream errors not fetched when server omits version.libxml-stream-perlUndecidedNewlibxml-stream-perl-1.22.try_stream_errors.patchpatch
309239Reason of failed connection is often not displayed.sendxmppUndecidedNewsendxmpp-1.14-GetErrorCode.patchpatch
309058Crashes on startup if there are invalid mapslabyrinthUndecidedNewPatch to let labyrinth start despite the presence of bogus mapspatch
308785lna control gpio on tiger minicard rev 2 is invertedlinux-ubuntu-modules-2.6.24UndecidedNewsms1xxx: fix inverted lna control on tiger dvb-t minicard rev2patch
308696partimaged refuse clients connections (socket CLOSE_WAIT nerver ends)partimageUndecidedNewPatch applied on partimage-0.6.7 directorypatch
307964OTR should close a session, if the other chat partner logs outpidgin-otrWishlistConfirmedCloses the OTR-session if the peer closes his sessionpatch
307873[PATCH] Linking error in molelfmolUndecidedNewPatch to add -D_FORTIFY_SOURCE=0 to CFLAGS in molelf directorypatch
307705libgweather shows unexpected iconslibgweatherWishlistNewicon.diffdiff
307652editline truncates at 64 characters in batch modeeditlineUndecidedNewfix for bug, based on debian editline 1.12 basepatch
307477DVDRAM GSA-T50L will not write DVD's or CD'sdvd+rw-toolsUndecidedNewT50L.rarrar
307471Multi bin printing broken in OpenOffice.org due to cupsys pstops filter bugcupsysUndecidedConfirmeddpatch for str2831dpatch
306923pidgin doen't show OS version via XMPPpidginUndecidedConfirmedFixed patch (based on the original submitted patch)patch
306923pidgin doen't show OS version via XMPPpidginUndecidedConfirmedpidgin-version.patchpatch
306430~/.ssh/config does not handle multiple hosts correctlyopensshUndecidedIn Progresschanges documentation to reflect programs behaviourdiff
306110slay defaults to "mean" mode where it will kill users own processes as a jokeslayUndecidedNewpatch to make slay default to "nice" modetxt
305530Service discovery applet doesn't implement smb supportservice-discovery-appletUndecidedNewAdded support for smb to nautilus plugindiff
305433Reuse translations in desktop filesapp-install-data-ubuntuUndecidedNewRemove the update of po files from desktopize.shpatch
305433Reuse translations in desktop filesapp-install-data-ubuntuUndecidedNewScript to generate po files from desktop filessh
305346zsh error on startup: /etc/zsh/zshrc:unalias:43: no such hash table element: run-helpzshUndecidedNewPatch for /etc/zsh/zshrcpatch_etc_zsh_zshrc
305346zsh error on startup: /etc/zsh/zshrc:unalias:43: no such hash table element: run-helpzshUndecidedNewzshrc.patchpatch
305281log_to_console() function breaks when /proc is missinglsbUndecidedNewPatch against /etc/lsb-base-logging.shpatch
305062Upgrade of package ca-certificates has many issues: install/upgrade: subprocess post-installation script returned error exit status 1 (while running final ldconfig)ca-certificatesMediumTriageddebdiff for 20081028ubuntu1 (option one: just bail out)debdiff
305062Upgrade of package ca-certificates has many issues: install/upgrade: subprocess post-installation script returned error exit status 1 (while running final ldconfig)ca-certificates-javaMediumTriageddebdiff for 20081028ubuntu1 (option one: just bail out)debdiff
303872lookup-el package doesn't depend on emacs-snapshot.lookup-elUndecidedNewcontrol.diffdiff
303646Intrepid: Missing ListNodes(), CreateNode(string) and RemoveNode(object) on org.bluez.DevicebluezUndecidedConfirmed0001-Revert-Add-API-definition-for-device-nodes.patchpatch
303082Add Win2k Terminal Server supportrdesktopUndecidedNewWindows 2000 Terminal Server license problem patchpatch
303074[intrepid] /etc/init.d/rc level parsing is fragilesysvinitUndecidedNewpatch to set level to the first two chars after [SK]patch
302919lcdproc: Futaba dm-140gink VFD device needs driverlcdprocWishlistConfirmedlcdproc-0.5.3 dm140 henlar v0.2 patchpatch
302693apt-cacher-ng hangs and corrupts packages (intrepid)apt-cacher-ngMediumTriagedacng_core_0.2.1-0.2.2.diffdiff
302468tar doesn't stop after extracting with --occurrence parametertarUndecidedNewtar-drain.diffdiff
302339nss_updatedb error message uncorrectly reports missing librariesnss-updatedbUndecidedConfirmednss-updatedb_10-1ubuntu2.debdiffdebdiff
301428In 'downloading package files' dialog change "Show for individual files" to "Show individual files"synapticLowIn Progress301428.diffdiff
301203slabtop --once seems to exit without outputprocpsUndecidedConfirmedprocps.debdiffdebdiff
301192libxcomp crashes on linux-sparcnxcompMediumTriagedpatch to add checks for "__sparc" macrodiff
301007auto backend discovery at start timematplotlibWishlistTriagedmatplotlib_0.98.5.2-1ubuntu4.debdiffdebdiff
301007auto backend discovery at start timematplotlibWishlistTriagedpatch to resolve bug [REJECT]debdiff
300396[PATCH] AudioPlayer.get_metadata should set title for PlayableModelsmoovidaUndecidedNewUse title if availablediff
300391[PATCH] Album-less music files don't report metadata over dbusmoovidaUndecidedNewReturn strings, not Nonediff
300146debconf.py should only mess with sys.stdout if we're using it for writingdebconfMediumTriagedPatch to fix this problem.patch
299029using the fast user switch applet or notification area icon to change pidgin status doesn't retain status messagefast-user-switch-appletWishlistTriagedPatch to indicator-me which stores the status message and reset it at each status change.diff
299029using the fast user switch applet or notification area icon to change pidgin status doesn't retain status messagepidginWishlistTriagedPatch to indicator-me which stores the status message and reset it at each status change.diff
297929Allow forwarding to multiple "root" recipientsssmtpUndecidedNewPatch against ssmtp-2.62patch
297814~/.recently-used.xbel cannot be a symlinkgtk+2.0LowTriaged099_follow_symlink_for_recent_files_database.patchpatch
297538traceroute doesn't work for less than 6 hopstracerouteUndecidedConfirmedinitialized sim_probes with -1 and if not overwritten by the command line parameters, it is set to DEF_SIM_PROBES. If it is greater then max_hops*probes_per_hop, we lower it to this value so we can use it to trace less than 6 hops without explicitly specifying the -N parameterdebdiff
296754/etc/init.d/hostname.dhcp has errorsnfsbootedUndecidedNewhostname.dhcp.patchpatch
296538warty-final-ubuntu.png is actually a JPEG fileubuntu-wallpapersLowIn Progressubuntu-wallpapers_0.28.1-0ubuntu2.tar.gzgz
296067spurious warning about `/var/lib/postgrey' on postgrey installpostgreyUndecidedNewadd a mkdir -p line near the toppatch
295809Patch for fixing LCD brightness on sony vaio VGN-FE31Hacpi-supportUndecidedNewpatch adds acpi brightness events matching my sony vaio laptoppatch
295434Incomplete/incorrect entries in LaTeX tablescim-tablesUndecidedConfirmedNew versionin
295401no workout preset data for kipina kipinaUndecidedNew0001-changed-debian-rules.patchpatch
295401no workout preset data for kipina kipinaUndecidedNewkipina_0.2.2-0ubuntu2.debdiffdebdiff
295020Launching pipe coprocess causes zombies after some timepdnsUndecidedConfirmedfix pipebackend filedescriptor leakpatch
294978vsock doesn't compilevmware-serverUndecidedNewPatch to vmware-config.pl to allow building of vsock module on kernel 2.6.27txt
294809epstopdf: generated pdf files are rotatedtexlive-binUndecidedConfirmedepstopdf.patchpatch
292762Static files NOT FOUND using the testing standalone serverturbogearsUndecidedConfirmedpatchpatch
292311pidgin-otr produces 3 identical menus in conversation windowspidgin-otrLowConfirmedRemoves extra "OTR" menu in menu bar of chat window.patch
292265The haskel.lang file in gtksourceview is wronggtksourceviewLowNewFixed diff-filegz
292265The haskel.lang file in gtksourceview is wronggtksourceviewLowNewPatch for gtksourceview2gz
292265The haskel.lang file in gtksourceview is wronggtksourceviewLowNewremoved . from the regex for typename or constructorslang
291987mysql-server-5.0 installation failsmysql-dfsg-5.0UndecidedConfirmedComment lines for installation process haven't got into count the undefined "INITOUTPUT" varpatch
291871Emacs hangs occasionally due to malloc calls in signal handleremacs21UndecidedNewFix for reentrancy bug through mallopt() (ported from emacs22).patch
291811Groovy and Grails support is missingshared-mime-infoWishlistTriagedgroovy-mime.xmlxml
291263kvpnc: needs ability to add "--script-security 2" to openvpn argskvpncUndecidedConfirmedscript-security.debdiffdebdiff
291184Mouse scrolling does not work in vim, mutt etc.vteLowTriagedalt_screen_scroll.diffdiff
291075Digital simulation in qucs don't workfreehdlUndecidedConfirmedpatch for freehdl libtool problemdiff
290935dual screen all panels end up on one screen at startupgnome-panelLowTriagedUse correct DISPLAY when using multiple screensdebdiff
290714weird looking gksu window for "password dialogs as normal windows"libgksuLowConfirmedlibgksu_2.0.12-1ubuntu5.debdiffdebdiff
290517headers include incorrect pathsgmmUndecidedNewfix the includesdiff
290177[huawei/option] NM 0.7: GSM connections won't work with PIN code protected modems - despite having supplied the correct PIN for the connection in nm-connection-editornetwork-managerMediumTriagednm-gsm-device.c.patchpatch
290159[patch] Dont disable Xinput because of drawing outside the boxcellwriterUndecidedNewConstrain the stroke to inside of the boxdiff
290127Non-existent log files cannot be chown'edsysklogdUndecidedNewsysklogd_1.5-5ubuntu4.debdiff2debdiff2
290085compiz-decorator script fails to parse XDG_CONFIG_DIRScompizLowTriagedparse_colon_xdg_config_dirs.debdiffdebdiff
289911[linux] Delay claiming dbus namemoovidaUndecidedNewdelay dbus claimdiff
289647C++ section doesn't workdoc-centralUndecidedNewdoc-central fixespatch
289367camellia cipher does not work in racoon - enable camellia in opensslopensslWishlistConfirmedenable.camellia.cipher.in.openssl.patchpatch
288905/etc/init.d/ntp doesnt use ntpdate to ensure clocks are aligned before starting server.ntpWishlistConfirmedPatch to sync and set hwclock if successful.patch
288877[DarkRoom] Add solid color to the top of tabsubuntu-artworkUndecidedConfirmeddarkroom_tabtop_solid_color.diffdiff
288497ircII crashed with SIGSEGV in free()irciiUndecidedConfirmedpatch.txttxt
288011dns resolver does not support dnssecglibcWishlistConfirmedAdd RES_USE_DNSSEC to glibc resolver optionspatch
288011dns resolver does not support dnssecglibcWishlistConfirmedRES_USE_DNSSEC & anslen patch for glibc 2.9, backported from 2.11 (excluding the Changelog file)patch
2878978.10 Cryptkeeper won't import an existing encrypted filesystemcryptkeeperUndecidedNewImportStashWizard.cpp.patchpatch
287689gthumb --import-photos doesn't work without manual unmount (unless you're English)gthumbUndecidedConfirmedintrepid debdiffdebdiff
287562Aide cron job fails because lock /var/run/aide/cron.daily.lock could not be obtainedaideUndecidedNewpatch for /etc/cron.daily/aidepatch
287472Some logging is done to stdout instead of stderrstraceUndecidedNewstrace.stdout.debdiffdebdiff
287262"Alt+C" access key does not work in time-admingnome-system-toolsLowTriagedChange the "Configuration" label and some Mnemonic widget settings in Interfaces folderpatch
287262"Alt+C" access key does not work in time-admingnome-system-toolsLowTriagedPatch Updated. "Configuration" uses Alt + G, "Time" uses Alt + Tpatch
286996mnogoclient + mysql can't connect to DB when trying to automatically configuremnogosearchUndecidedConfirmedmnogo.diffdiff
286996mnogoclient + mysql can't connect to DB when trying to automatically configuremnogosearchUndecidedConfirmedmnogo2.diffdiff
286972No item for mapivi in Xfce menumapiviLowTriagedPatch to add .desktop entrypatch
285815Backlight keeps getting darker on MacBookPrognome-power-managerLowConfirmed94-fix-light-sensor-scaling.patchpatch
285815Backlight keeps getting darker on MacBookPrognome-power-managerLowConfirmedImproved patchpatch
285815Backlight keeps getting darker on MacBookPrognome-power-managerLowConfirmedreport light sensor value correctly on newer MacBookspatch
285530sysklogd init script speedup (patch included)sysklogdUndecidedNewinit scriptsysklogd
285089[138A:0001] fingerprint reader not recognizedlibfprintMediumIn Progresslibfprint-0.3.0-vfs101.patchpatch
285089[138A:0001] fingerprint reader not recognizedlibfprintMediumIn Progresslibfprint-0.3.0-vfs101.v5.patchpatch
284968Jigsaw fails to launchsugar-jigsawpuzzle-activityMediumIn Progressjigsaw_launch.patchpatch
284672pthread_mutex_timedlock segfault on multi-proc x86_64glibcMediumTriagedlowlevellock-x86_64.diffdiff
283953Catfish' default search directory is /usr/share/catfishcatfishLowConfirmedcatfish-fix-283953.diff -- BADdiff
283953Catfish' default search directory is /usr/share/catfishcatfishLowConfirmedcurdir.diffdiff
283376Network manager sends CHAP response in wrong formatnetwork-manager-pptpUndecidedNewfix-pptp-domain-usage.patchpatch
282410beaglefs doesn't workbeaglefsUndecidedConfirmednew hit.cc
282249[redhat-cluster-suite] scsi_reserve is missing in the cman packagecmanUndecidedNewredhat-cluster_2.20080227-0ubuntu1_2.20080227-0ubuntu2~ppa1.diff.gzgz
280557tilda has no watch filetildaLowTriagedtilda_0.09.6-1ubuntu1.debdiffdebdiff
280086IPTraf 3.0.x : fix VLAN no trafficiptrafUndecidedConfirmedVLAN no traffic (fix)patch
279557rsync does not implement PATH_MAX for large file pathsrsyncUndecidedNewPatch for rsync 2.6.9-6ubuntu2.patch
279545zsh completion broken for svn 1.5zshUndecidedConfirmed_subversion.diffdiff
279054pppoe-server handles offset option incorrectlyrp-pppoeUndecidedNewpppoe server patch to fix -u offset handlingdiff
278427Broken compilationalsa-driverLowTriagedalsa-include-mm.patchpatch
278427Broken compilationalsa-driverLowTriagedmissing_include.patchpatch
278418human-icon-theme no longer replaces System->Administration iconhuman-icon-themeMediumTriageddebdiff to fix thisdebdiff
277902update-manager crashed with TypeError in _get_last_apt_get_update_text()language-support-arUndecidedNewreplace %s to %idiff
277589sony brightness on a geforce series older than 8 (nvclock works fine)halMediumIn Progresshal-system-lcd-get-brightness-linux.diffdiff
277589sony brightness on a geforce series older than 8 (nvclock works fine)halMediumIn Progresshal-system-lcd-set-brightness-linux.diffdiff
277404hp laserjet postscript text print does not print some characterspopplerMediumTriageddebdiff for an Intrepid SRU to fix this bugdebdiff
276545Missing implementation gdk_window_invalidate_rectlablgtk2UndecidedNewBinding for gdk_window_invalidate_rectdiff
275450menu items missing on fresh install of UbuntuonboardHighTriagedMenu items and debian/control changesdiff
275450menu items missing on fresh install of UbuntuonboardHighTriagedPatch to make the menuitems appear in the Universal Access menudiff
275423intrepid madwifi ath5k with AR242x not detecting all wireless networks and link speed is very poorlinux-backports-modules-2.6.27UndecidedConfirmedUse a spinlock around ath5k_hw_resetath5K_cant_reset_hardware_bobcopeland
275423intrepid madwifi ath5k with AR242x not detecting all wireless networks and link speed is very poormadwifi-toolsUndecidedNewUse a spinlock around ath5k_hw_resetath5K_cant_reset_hardware_bobcopeland
275122[SRU] wordnet 1:3.0-2 in Gutsy was not built with debian/patches applied as intended.wordnetUndecidedConfirmeddebdiffdebdiff
274514CVE-2008-3949: python execution from current directoryemacs22LowConfirmedSuSE lisp fixespatch
273984Wrong server path for CentOS-4 in rinse.confrinseUndecidedNewrinse.conf.patchpatch
273732libldap-ruby has memory corruption errorslibldap-rubyUndecidedNewnew_dangling_ptr.patchpatch
273557Quarry help does not find a web-browserquarryUndecidedConfirmedReplace direct mozilla call with call to xdg-open util (313 bytes, text/plain)patch
273077Libgweather locations does not include Sheffield, UKlibgweatherWishlistConfirmedlibgweather_sheffield.diffdiff
272290Man pages show wrong Unicode characters instead of ASCIIgroffUndecidedNewThe patch I mentioned.patch
272171Firefox should not steal focus when told by another application to open a linkubufoxWishlistConfirmedubufox_0.6~pre+bzr141-0ubuntu2.debdiffdebdiff
272010Some plugins lack proper ubufox integration (Was: confusing plugin selection dialog)ubufoxUndecidedNewtotem fixdebdiff
271656Support for QWERTZ keyboard layout missingzynaddsubfxUndecidedNewPatch to fix the bug, downloaded from project trackerpatch
270638lrzsz xmodem doesn't worklrzszUndecidedConfirmedPatch to fix xmodem send problempatch
270580smbldap-groupmod fails to remove a non-ldap user from an ldap groupsmbldap-toolsUndecidedNewsmbldap-groupmod-check-for-undefined_user_entry.patchpatch
270512openssh-client could suggest xauth rather than recommend itopensshLowConfirmedopenssh_5.1p1-1ubuntu3.debdiffdebdiff
270019Arabic support in icewmicewmUndecidedConfirmedfribidi.patchpatch
268913d4x cannot handle urls that contain ~ and some other characters allowed by HTTPd4xUndecidedNewThis is how I fixed this bug on my local machinediff
268734immediate shutdown after pressing shutdown buttonacpidUndecidedConfirmedacpi-powerbtn-kde4.patchpatch
268494Maximus needs more options for window excluding/includingmaximusMediumConfirmedinclude_classpatch
268143smart should treat Recommends as apt doessmartUndecidedConfirmedsmart-deb-suggests.diffdiff
268143smart should treat Recommends as apt doessmartUndecidedConfirmedsmart-rpm-suggests.diffdiff
267513Wrong translation of "Greek Modern"iso-codesLowTriagedpatch.diffdiff
267326teeworlds-server has no init script and no sample configuration fileteeworldsWishlistNewteeworlds-server init scriptteeworlds-server
267302Gnat-gps trouble on startgnat-gpsUndecidedNewgnat_switches.pypy
267260Review dependencessun-java6UndecidedConfirmedPatch in debdiff format.debdiff
267260Review dependencessun-java6UndecidedConfirmeddebdiff, to change the browser dependencies into suggestionsdebdiff
264967/usr/bin/script doesn't wait for command to finish before exitingutil-linuxUndecidedConfirmedPatch to make /usr/bin/script wait for command to finish before exitingpatch
264752Meanwhile user status detection brokenmeanwhileUndecidedConfirmedmeanwhile-status.diffdiff
264697Module fcpci not found.isdnutilsUndecidedNewComments out calls to deprecated find_task_by_pid functionc
264697Module fcpci not found.isdnutilsUndecidedNewpatch.fcdslsl.driver.cc
264697Module fcpci not found.linux-restricted-modulesUndecidedNewComments out calls to deprecated find_task_by_pid functionc
264697Module fcpci not found.linux-restricted-modulesUndecidedNewpatch.fcdslsl.driver.cc
264144NetworkManager VPN configuration export does not worknetwork-manager-pptpMediumTriagedpatch from git (f6bebbfbd04cce2ab93ac9efb7b99bb54b5ba09d)patch
264123please remove ttf-manchufont from dependencyttf-manchufontLowTriagedremove depend: ttf-manchufontdebdiff
263944Booting OS from SD card reader(through SDIO interface)grub2UndecidedNewPatchzip
263944Booting OS from SD card reader(through SDIO interface)linuxUndecidedConfirmedPatchzip
262853ov51x-jpeg-source won't build against kernel 2.6.27, but 1.5.9 (already in Jaunty) would.ov51x-jpegHighConfirmedov51x-jpeg.diffdiff
262548STONITH agent external/ibmrsa-telnet is broken (fails with parameters passed by stonithd)heartbeatUndecidedNewRemoves the check for exactly one argumentpatch
261889Ping doesn't report bad checksum packets.iputilsUndecidedNewping_bad_checksum.diffdiff
261695pidgin crashes in libmeanwhile just after connectingmeanwhileUndecidedNewdebdiffdebdiff
261695pidgin crashes in libmeanwhile just after connectingmeanwhileUndecidedNewmeanwhile-mwSametimeList_get.patchpatch
260918needed: libv4l and associated application patches (or "gspca stopped working in 2.6.27")camoramaUndecidedConfirmedDebdiff for camoramadebdiff
260918needed: libv4l and associated application patches (or "gspca stopped working in 2.6.27")camoramaUndecidedConfirmedcamorama_0.19-2ubuntu0.1.debdiffdebdiff
260567cpufreqd crashed on startupcpufreqdMediumConfirmedcpufreqd-2.4.2-battery-crash.patchpatch
260210gnome-session-remove man pagegnome-sessionLowTriageddebdiffdebdiff
259830Honor gnome proxy settinggwibberWishlistTriagedPatch for gwibber-2.29.92.1diff
259830Honor gnome proxy settinggwibberWishlistTriagedgwibber-proxy-libproxy.patchpatch
259003Installing aliases for virtual robots automaticallysympaUndecidedNewPatch for alias_manager.plpatch
258782it'd be nice to have a --no-scripts flagifupdownWishlistTriagedifupdown_no_scripts.diffdiff
258573Courier and exim use an incompatible db librarycourierWishlistTriagedcourierdb.patchpatch
258075sshmenu freezes when draging hosts/submenussshmenuUndecidedConfirmedPatch to disable drag-n-droppatch
257996No reciprocal functiongalculatorWishlistTriagedChanges "CMP" key to "1/x (DEC) or CMP (HEX/OCT/BIN)"patch
257901Suggestion: GUI frontend(s) for ecryptfs-utilsecryptfs-utilsWishlistTriagedcosmeticspatch
257724vnc4server startup script errorvnc4LowTriageddebdiff xinit_1.0.9-2 xinit_1.0.9-2ubuntu1~ppa1diff
257639E: The package cache file is corrupted E: _cache->open() failed, please report.update-managerMediumTriageda different approach to solve the problem inside PKpatch
257377REGRESSION: Pommed does not see brightness-up/down key events when on an X11 VTpommedUndecidedNewfix-leds-filename.patchpatch
257241Playing local files does not use information from the databasemoovidaUndecidedNewCheck library for music filediff
257178education-chemistry: fails to install: err 67: Custom distribution education does not existcddUndecidedTriagedcdd_0.4.4_to_0.4.7.diffdiff
257115config-handler assumes group name matches user nameubuntu-vm-builderUndecidedNewconfig-handler.group.patchpatch
257093tmpreaper should automatically avoid /tmp/aquota.{user,group}tmpreaperUndecidedNewPatch for (installation path) /etc/cron.daily/tmpreaperpatch
257090No option to specify bridged interfacesubuntu-vm-builderUndecidedNewbridged-networks.patchpatch
257071Unnecessary build dependency on makedependbclockUndecidedConfirmeddebdiffdebdiff
256908can't normal parse HEX filesfxloadUndecidedConfirmedfxload hex-files bug correctionpatch
256712crashes when connection dropslastfmsubmitdMediumTriagedPatch to fix bug: catch socket exceptionsdiff
256179libeditline does not support home/end/delete keyseditlineWishlistTriagedEnables home/end/delete keys to work as expecteddiff
256179libeditline does not support home/end/delete keyseditlineWishlistTriagedEnables home/end/delete keys to work as expecteddebdiff
256091ldapscripts in hardy tries to read /etc/pam_ldap.confldapscriptsUndecidedConfirmedone line patchdebdiff
255794Exim queue handling: allow alphanumeric ACL namesmailscannerUndecidedNewconverted acl variables from arrays to hashescdiff
255307Can't connect to msn accountspymsnMediumConfirmeddebdiff against current hardy versiondiff
2553040.7, 3G - Fails to cope with provider lock requiring unlock codenetwork-managerLowTriagedpatch to fail more gracefullydiff
255225[Hardy] Hight Quality Options does not fit ffmpeg versionkinoUndecidedNewffmpeg_utils.sh.diffdiff
255030Eog creates thumbnails even when deactivated in gnomeeogLowTriagedeog-bug-551171.patchpatch
254104check for missing symbols in backport moduleslinux-backports-modules-2.6.24UndecidedNew0001-Add-check-modules-flavour-target.patchpatch
253971FindGLUT.cmake broken for *nix systemscmakeUndecidedNewFindGLUT-nix.patchpatch
253843don't quote log prefixfireholLowTriagedfirehol.patchpatch
253230qemu-kvm should Build-Depends on libvdeplug2-dev (KVM vde2 support not working)vde2WishlistTriagedJaunty debdiffdebdiff
253192innodb_recover calls mysql with wrong pid file argumentmylvmbackupUndecidedNewpidfile patchmylvm
253163segfault of jfbterm in intrepid with uvesafbjfbtermUndecidedNewPatch to fix the segfault issuepatch
252882crash on multiple db install with dbc_dbpass in configdbconfig-commonMediumConfirmedAnother approachpatch
252882crash on multiple db install with dbc_dbpass in configdbconfig-commonMediumConfirmeddbconfig_debdiffdbconfig_debdiff
252882crash on multiple db install with dbc_dbpass in configdbconfig-commonMediumConfirmeddpkg-common.patchpatch
252589Metacity should be responsible for maximising windowsmaximusWishlistConfirmedMetacity patch to add maximus-like behaviourpatch
251853Clipboard operation doesn't work properly in regexxerregexxerUndecidedNewmainwindow.cc.patchpatch
251795/etc/environment PATH should not have quoteskrb5LowConfirmedfix-quote-expansion.patchpatch
251795/etc/environment PATH should not have quoteskrb5-applLowConfirmedfix-quote-expansion.patchpatch
251709rdesktop works bad with several keyboard layoutsrdesktopUndecidedConfirmedFixes -K behaviour in the raw keyboard patch.patch
251709rdesktop works bad with several keyboard layoutsrdesktopUndecidedConfirmedmod2mod2
251632DHCP client should not create temporary files in /etcdhcp3UndecidedConfirmedPatch for version 3.1.2-1ubuntu7 (Ubuntu 9.10)patch-new
251632DHCP client should not create temporary files in /etcdhcp3UndecidedConfirmeddhclient-script.patchpatch
251335Synaptic searches on UI threadsynapticMediumConfirmedsearch.patchpatch
250680Actions plugin shows menu for "no match" (fix included)glipperUndecidedNewactions.patchpatch
250680Actions plugin shows menu for "no match" (fix included)glipperUndecidedNewactions.py.patchpatch
250664"Device Manager" entry not appearing in System -> Administration (faulty gnome-device-manager.desktop)gnome-device-managerLowConfirmedgnome-device-manager.desktopdesktop
250476t-s-e does not allow null sourcestelepathy-stream-engineUndecidedNewThis allows there to be no FS_AUDIOSRCdiff
250473example call.py insists on doing video callstelepathy-pythonUndecidedNewSlightly old patch which switches the call type to audio-onlydiff
250467example call.py does not handle SIGTERMtelepathy-pythonUndecidedNewThis is an attempt at a SIGTERM handler, but it doesn't seem to work - perhaps other signals are at work?diff
249957wrong count in update-notifier tooltipupdate-notifierWishlistTriagedMy modified apt-check scriptapt-check
249957wrong count in update-notifier tooltipupdate-notifierWishlistTriagedbug-249957.diffdiff
249362extlinux cannot install when it is usb-booted.syslinuxUndecidedNewbackported into syslinux_3.36t
248630UMTS PCMCIA modem not picked upnetwork-managerUndecidedConfirmedCorrection of command to allow manual network choicediff
247687Please backport "Satisfy Any" patchcupsysWishlistNewSTR2782 patch applied to hardy sourcepatch
246738zatacka does not show the lines of the playerzatackaUndecidedConfirmedThis is the errorpng
245728runit doesn't stop and /var isn't umounted on shutdownrunitMediumNewrunit_2.1.1-4ubuntu2.debdiffdebdiff
245590patch for generating unicorn_pci_atm module on 2.6.24-16-generic and laterunicornUndecidedNewdiff with current unicorn_pcidrv.cpatch
244141Grub: Add detection of bootable disk partitions by UUIDgrub-installerUndecidedNewUUID grub documentation diffdiff
244141Grub: Add detection of bootable disk partitions by UUIDos-proberUndecidedNewUUID grub documentation diffdiff
243953cursor not showing in mc 4.6.2 with visible whitespace featurevteLowTriagedvte-0.16.13-mc-cursor.patchpatch
243469Can't install j2re1.4 packages built by make-jpkg in Hardy due to conflict with xulrunner-1.9java-packageUndecidedIn Progressjava-package_0.39ubuntu1.debdiffdebdiff
243469Can't install j2re1.4 packages built by make-jpkg in Hardy due to conflict with xulrunner-1.9xulrunner-1.9MediumIn Progressjava-package_0.39ubuntu1.debdiffdebdiff
243384Incorrect argument passing from ip-up to ip-up.localpppUndecidedNewip-down.patchpatch
243384Incorrect argument passing from ip-up to ip-up.localpppUndecidedNewip-up.patchpatch
243344scim-bridge crashed with SIGSEGV in scim::IMEngineInstanceBase::get_frontend_data()scim-bridgeHighConfirmedscim-bridge_0.4.14-2ubuntu6.debdiffdebdiff
243156bibtex autokey no longer ignores uncapitalized title wordsemacs-snapshotUndecidedNewPatch for Emacs 22.2 bibtex.elpatch
243156bibtex autokey no longer ignores uncapitalized title wordsemacs-snapshotUndecidedNewUpdated patch for 23.0.90.1patch
243156bibtex autokey no longer ignores uncapitalized title wordsemacs22UndecidedConfirmedPatch for Emacs 22.2 bibtex.elpatch
243156bibtex autokey no longer ignores uncapitalized title wordsemacs22UndecidedConfirmedUpdated patch for 23.0.90.1patch
241206Gnome Screensaver does not activate reliablygnome-screensaverLowIn Progress110_gnome-session-2.30.0__gnome-session__gsm-manager.cc
241206Gnome Screensaver does not activate reliablygnome-screensaverLowIn Progress21_gnome-screensaver-2.30.0__src__gs-listener-dbus.c.patchpatch
241206Gnome Screensaver does not activate reliablygnome-screensaverLowIn ProgressGuarantee reset_idle_watch is called whenever idle watch timer expirespatch
241053loop-aes module is not available when update-initramfs is runloop-aes-utilsUndecidedNewsame patch as originally posted in-linepatch
240915Add support for ACPI event handler for Sony Vaio with SNC controlleracpi-supportUndecidedNewPatch for adding also SNC handler for sony laptopspatch
240537Problems with licd.conf.atilibusb (Snapstream X10)lircLowTriagedCleaned up code for ss firefly remotessfirefly
240266xvkbd UK layout errorxvkbdUndecidedNewNote: first patch; please forgive me but correct me if I did it wrong!patch
239906Dependency on libbsf-java is invalidgroovyUndecidedConfirmedgroovy_1.5.6-1ubuntu1.debdiffdebdiff
239877Gmount-iso does not allow to mount files with other extentionsgmountisoUndecidedConfirmedAdds support for selecting .mds files and uppercase ISOdiff
239739haxe-mode.el does not install cleanlyhaxeUndecidedNewNaive patchpatch
239670libboost1.3?-dev should include dev toolsboost-buildWishlistNewboost-build_2.0-m12-2ubuntu1.debdiffdebdiff
239670libboost1.3?-dev should include dev toolsboost-buildWishlistNewboost-build_2.0-m12-3.debdiffdebdiff
239670libboost1.3?-dev should include dev toolsboost-buildWishlistNewboost1.37_1.37.0-3ubuntu4.debdiffdebdiff
239670libboost1.3?-dev should include dev toolsboost-buildWishlistNewboost1.38_1.38.0-7.debdiffdebdiff
238970wrong ownership in /var/lib/cyrus etc.cyrus-imapd-2.2UndecidedNewfixes \( and \) grouping in calls to finddiff
238481openobex-1.3 does not correctly work with non-English chars in phone filesystemlibopenobexUndecidedNewopenobex-1.3-utf.patchpatch
238412default mime-type option is ignoreds3cmdUndecidedNews3cmd_default_mimetype.patchpatch
238321groups script output change gutsy -> hardycoreutilsLowTriagedgroups.patchpatch
238259Building amd64 module for virtualbox-ose fails.virtualbox-ose-modulesMediumTriagedpatch for debian/rules to set ARCH=x86_64 based on "uname -m" returning x86_64patch
238192no man page for 'kphone'kphoneLowTriageddebdiff gzippedgz
237118ifplugd does stop on suspend, but does not start again with resumeifplugdUndecidedNewPatch for /etc/apm/scripts.d/ifplugdpatch
236837Axel-kapt uses all memory and CPU resourcesaxelUndecidedConfirmedUse @string()diff
236737Exception during a call SOAP method by ServiceProxy because of invalid "str" callzsiUndecidedNewServiceProxy.py.diffdiff
236697Exception while call SOAP method by ServiceProxy if there is keyword argument "name"zsiUndecidedNewmore common patchgz
236491wodim refuses to recognise Pioneer DVR-A09 can write at speeds above 4xcdrkitUndecidedNewcdrkit-tom.patchpatch
236344Extra line break occurs after typing password or cancelingthinkfingerUndecidedConfirmedPatch to pam_thinkfinger.c to undo the erroneous extra . Patched against the file in thinkfinger_0.3+r118.orig.tar.gzpatch
236159the arrow showing the song currently played disappearssound-juicerLowTriagedsound-juicer.patch.tar.gzgz
236159the arrow showing the song currently played disappearssound-juicerLowTriagedsound-juicer.patchv2.tar.gzgz
236159the arrow showing the song currently played disappearssound-juicerLowTriagedsound-juicer.patchv3.tar.gzgz
236159the arrow showing the song currently played disappearssound-juicerLowTriagedsound-juicer.patchv4.tar.gzgz
236159the arrow showing the song currently played disappearssound-juicerLowTriagedsound-juicer_2.22.0-patch4.diff.gzgz
236046checkgmail tray background colour cannot be changedcheckgmailLowTriagedcheckgmail-fix404.patchpatch
236046checkgmail tray background colour cannot be changedcheckgmailLowTriagedcheckgmail.patchpatch
236040alsa-firmware loader fails for tascam us-122 (and probably others)alsa-toolsLowConfirmedtascam_fw.diffdiff
235137hobbit-client fails to load config due to missing /var/run/hobbithobbitUndecidedConfirmedAdds some code to create the directory at startup if it is missingpatch
234593Segmentation fault when no System.map could be openedsysklogdUndecidedNewsysklogd-1.5-segfault.patchpatch
233976Double-free following scan on ubuntu hardy 8.04 with epjitsu fi-60fsane-backendsUndecidedNewepjitsu.h.diff and epjitsu.c.diff concatenatedtxt
233784Local printer on remote desktop via RDPtsclientLowTriagedAdd printer redirection supportpatch
233784Local printer on remote desktop via RDPtsclientLowTriagedPrinter redirection patch for tsclient_0.150-1ubuntu6patch
232358Read Message function misbehavespidgin-hotkeysUndecidedNewPatch to tackle the problempatch
231495ipe file dialog problemipeUndecidedNewpatch to fix filedialog problempatch
231266Cannot resize text input area in PidginpidginWishlistConfirmedDebdiff as requested in https://wiki.ubuntu.com/MOTU/Contributingdebdiff
231266Cannot resize text input area in PidginpidginWishlistConfirmedmodified from http://developer.pidgin.im/ticket/5252 to work with pidgin 2.4.1patch
230527FTBFS: error: size of array `_dummy' is negativeposeUndecidedConfirmed30_amd64_compile_lp230527.dpatchdpatch
229760RFE: allow permanent setting of distribution for dchdevscriptsWishlistNewextra_config_options.patchpatch
229632ntpd should run nicedntpLowTriagedAdds an option to /etc/default/ntp to make the priority level of ntpd configurable.patch
229632ntpd should run nicedntpLowTriagedRun ntpd at nice -8patch
228850firefox wpad.dat report incorrect myIpAddress()firefoxUndecidedConfirmedproxy_ff.patchpatch
228554no Asia/BeiJing option in TimeZonetzdataUndecidedIn Progressbeijing.diffdiff
228554no Asia/BeiJing option in TimeZonetzdataUndecidedIn Progressbeijing.patchpatch
226780apt-key net-update does not obey APT::Acquire::http::ProxyaptMediumTriagedetc-cron.daily-apt.patchpatch
226609File truncation fails within CFS mounted directorycfsUndecidedNewFixes CFS Bug #226609, and another latent bugpatch
226219automount doesn't work with NFS rootautofsUndecidedConfirmedautofs.diffdiff
224559Image on webcam is upside-downlibv4lWishlistTriagedPatch to add USB id 064e:a136 to the vflip table of libv4libdiff
224559Image on webcam is upside-downlibv4lWishlistTriagedmy version of image rotate patchpatch
224559Image on webcam is upside-downlibv4lWishlistTriagedul50vg-flipped.patchpatch
224460apt-cache shows misleading dependency informationaptMediumTriagedapt_0.7.14ubuntu4.debdiffdebdiff
224389bluetoothd-service-network fails to bring up the server side bnep interface after reconnectionbluez-utilsUndecidedNew008_ifup_script_execution_fix.patchpatch
224389bluetoothd-service-network fails to bring up the server side bnep interface after reconnectionbluez-utilsUndecidedNew008_server_bnep_ifup.patchpatch
224003Error importing lightbluepython-lightblueUndecidedConfirmedFix the imports in _lightblue.pypatch
223594lzma support breaks unsquashfs endian swapsquashfsUndecidedConfirmed00-sqlzma-tools-bugfix-endianness.patchpatch
223594lzma support breaks unsquashfs endian swapsquashfsUndecidedConfirmedupdated patch from 2008 that i applied to my own packagepatch
222779XGalaga: Key pad and sound do not function on latest version of Hardy HeronxgalagaUndecidedConfirmedpatch for xgalaga.desktoppatch
222663rme hdsp firmware is not loaded at system startupalsa-toolsMediumConfirmedPatch against current medibuntu alsa-firmware package to drop the patch moving the hdsp firmwares in an unexpected place, notably for the kernel.patch
222663rme hdsp firmware is not loaded at system startupalsa-toolsMediumConfirmedPatch against current universe alsa-tools source package providing alsa-firmware-loaders binary package, to tell hdsploader to seek for its firmwares in the place expected by the kernelpatch
222663rme hdsp firmware is not loaded at system startupalsa-toolsMediumConfirmedcorrect firmware path in kernelpatch
222458/lib/udev/hdparm Compares Against $DEVNAME.hdparmUndecidedConfirmedhdparmhdparm
222458/lib/udev/hdparm Compares Against $DEVNAME.hdparmUndecidedConfirmedpatch against /lib/udev/hdparmpatch
222146Segfaults with Python 2.5python-cdbUndecidedTriagedSimple patch against python-cdbpatch
221946argo.user.properties should not be in $HOMEargoumlUndecidedNewPatch to move argo.user.properties to $HOME/.argoumlpatch
221363Policy Kit Unlock Buttons Greyed Out when using NX / VNC / LTSPsystem-tools-backendsMediumTriagedpolkit-systemtools-remote-allow.patchpatch
220142Yelp:ERROR:(yelp-document.c:275):yelp_document_cancel_page: assertion failed: (document != NULL && YELP_IS_DOCUMENT (document))yelpMediumTriaged10_fix_free_crash.patchpatch
220142Yelp:ERROR:(yelp-document.c:275):yelp_document_cancel_page: assertion failed: (document != NULL && YELP_IS_DOCUMENT (document))yelpMediumTriaged11_fix_cancel_page_crash.patchpatch
219867Fsck Check Doesn't Remove All Text After Finishedusplash-theme-ubuntuLowConfirmedusplash-main.diffdiff
219867Fsck Check Doesn't Remove All Text After Finishedusplash-theme-ubuntuLowConfirmedusplash-theme.diffdiff
219635supplied version of ivman doesn't support condition valuesivmanUndecidedConfirmedPatch found at link (I didn't write it)diff
219280FTBFS in latest archive rebuild testxen-3.2HighConfirmeddebdiffdebdiff
218974Notification when plugin a webcamhalWishlistNewpatch to qc-usb-0.6.6 with kernel 2.6.24patch
218965preseeding hostname doesn't work in a network installnetcfgHighTriagedkeep the netfcg/get_hostname from syslinux or preseeddiff
218965preseeding hostname doesn't work in a network installnetcfgHighTriagedreload netcfg if netfcg/get_hostname is present in the network preseeddiif
217876Firefox 2 remains in gusty -> hardy upgrade when lang-packs are installedaptMediumConfirmed(debdiff) flip order in Depends:debdiff
217798tsclient should recognize Xephyr for XDMCP logintsclientUndecidedNewXephyr Additionpatch
217798tsclient should recognize Xephyr for XDMCP logintsclientUndecidedNewXephyr Addition for Maverickpatch
217787cups crashes when using web-gui and refuses to printsambaUndecidedTriagedapparmor_2.1+1075-0ubuntu9.1.debdiffdebdiff
217611apturl supportgnome-terminalWishlistConfirmedgnome-terminal_2.22.1-0ubuntu3~ppa1.debdiffdebdiff
217611apturl supportgnome-terminalWishlistConfirmedpidgin_2.4.1-1ubuntu3~ppa1.debdiffdebdiff
217611apturl supportgnome-terminalWishlistConfirmedxchat-gnome_0.18-2ubuntu5~ppa1.debdiffdebdiff
217611apturl supportgnome-terminalWishlistConfirmedxchat_2.8.4-0ubuntu8~ppa1.debdiffdebdiff
217485buffer overflow in parsing routines' from `Aborts when running with -r flagpgp4pineUndecidedConfirmedpatch from debiantxt
217182Rotate Screen in TabletPC stylus and pointer mouse not coincidenceacpi-supportMediumTriagedPatches rotatescreen.sh to update tablet orientationpatch
216847sshd will not start at boot if ListenAddress is set, because network interface is not yet upopensshLowConfirmedpatch with my changes to /etc/init/ssh.confpatch
216457Incomplete/broken java support, app stallssun-java6UndecidedIn ProgressNew, seperate deb that works!!deb
215090Xfce about dialog does not display xubuntu/ubuntu versionxfce4-utilsWishlistTriagedThe patchpatch
214987page-crunch defaults to trying to use missing viewerspage-crunchLowConfirmedpage-crunch-patch.diffdiff
213990[upstream] Romanian spell-check dictionary doesn't include namesopenoffice.org-dictionariesWishlistTriagedmyspell-ro_20070502-0ubuntu2.debdiffdebdiff
213830Terminal : don't resize the background picturegnome-terminalWishlistTriagedadded background image scalingpatch
213830Terminal : don't resize the background picturegnome-terminalWishlistTriagedadded background image scaling (rev2)patch
211747kdetv: bug in dcop function "navigate" from teletext interfacekdetvLowNewtelex.cpp.patchpatch
211726losetup fails when using the 'file:/', preventing the DomU from being createdxen-3.2UndecidedConfirmedxen-create-image.patchpatch
209256different hintstyle issuecairoWishlistTriagedrespect-fontconfig-ultimate.diffdiff
208855ImportError: No module named ext.readerzsiLowTriagedA workaround to make Sonata fetch lyricsdiff
208655After removing selinux, warnings while bootingselinuxLowConfirmedselinux.postrm.remove.patchpatch
206829Pidgin chat window border is excessively paddedpidginLowTriagedRemove padding set in VBoxpatch
206822tbb-examples Makefile uses nonexistant commandtbbUndecidedConfirmedtbb-examples patch to 2.0r014-4_all.debdeb
204960[Hardy] Lirc devinput (linux-input-layer) brokenlircWishlistIn ProgressPatch to lirc for hal to ignore FusionHDTV5 RT Gold i2c IR inputpatch
204898Better (non-linear) volume controlasmixUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controlawn-extrasUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controlgamixUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controlgnome-alsamixerUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controlkdemultimediaUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controllibaudio-mixer-perlUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controllibgtk2-ex-volumebutton-perlUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controlpavucontrolUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controlvolumecontrol.appUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204898Better (non-linear) volume controlwmixUndecidedNewexperimental logarithmic volume control debdiffdebdiff
204011Alternative import structure, based on import rollsf-spotWishlistTriagedCore changes to support custom format and roll namesdiff
204011Alternative import structure, based on import rollsf-spotWishlistTriagedExtension to safely manage custom formatdiff
204011Alternative import structure, based on import rollsf-spotWishlistTriagedStops changing EXIF timepatch
204011Alternative import structure, based on import rollsf-spotWishlistTriagedUI changes to support roll namesdiff
204011Alternative import structure, based on import rollsf-spotWishlistTriagedmeden_custom-path-format.diffdiff
203994apt-zip MD5 check breaks with apt SHA256 checksapt-zipUndecidedConfirmedall_algs.diffdiff
203236Thunar Toolbar icons are very largethunarLowTriagedthunar_toolbar_big_icons.patchpatch
202327freeciv package descriptions don't explain the differences between the clientsfreecivWishlistTriagedfreeciv_2.1.5-2ubuntu1.debdiffdebdiff
199853mp3rename -p gives errormp3renameUndecidedConfirmedNon ascii characters workaroundpatch
199853mp3rename -p gives errormp3renameUndecidedConfirmedmp3rename-0.6-p.patchpatch
199486ConsoleKit integrationume-config-commonUndecidedNewLatest ck-launch-session patchpatch
199486ConsoleKit integrationume-config-commonUndecidedNewNew ck-launch-session back port patchpatch
199486ConsoleKit integrationume-config-commonUndecidedNewck-launch-session back portpatch
199486ConsoleKit integrationume-config-commonUndecidedNewck-launch-session with Xsession startup scriptpatch
198138Installer/wget is unable to retrieve files via a proxyapt-cacherUndecidedNewpatch to apt-cacher to workaround busybox wget issuediff
198138Installer/wget is unable to retrieve files via a proxybusyboxLowConfirmedpatch to apt-cacher to workaround busybox wget issuediff
197478ported from obsolete GTK1.2 to GTK2e16menueditWishlistIn ProgressDebdiff for e16menuedit_0.1.3-3ubuntu1debdiff
197132Corewars should recommend neditcorewarsWishlistTriagedChanges the default corewars' editor to "editor", fixing bug #197132.debdiff
197132Corewars should recommend neditcorewarsWishlistTriagedChanges the default corewars' editor to "editor", fixing bug #197132. (patch for Jaunty)debdiff
197132Corewars should recommend neditcorewarsWishlistTriagedPatch that fix bug #197132.debdiff
197132Corewars should recommend neditcorewarsWishlistTriagedcorewars_0.9.13-1ubuntu1.debdiffdebdiff
197048If nick is taken telepathy-idle failstelepathy-idleMediumTriagedPatch to append "_" on the nickpatch
196365scponly-4.6* doesn't support new -l/-f option of sftp-serverscponlyUndecidedConfirmedAllowing -l and -f option for sftp-serverpatch
196317wrong dutch grammar in audio: "het letter" should be "de letter"gcomprisLowConfirmedclick op de letter (male voice)ogg
196135Timidity shouldn't depend on freepatsfluid-soundfontLowTriageddebdiff: Do not depend on freepatsdebdiff-ubuntu2
195690Package deployment action store not working.ocsinventory-agentUndecidedConfirmedDownload.pm.diffdiff
195483Sound Juicer - MP3 quality doesn't changesound-juicerLowTriagedpatch for /usr/share/gconf/schemas/gnome-audio-profiles.schemaspatch
194769xfce4-terminal window borders / decorations / widgets being incorrectly drawn (xubuntu 8.04)xfce4-terminalLowConfirmedPatch to 0.2.8 to fix MediaMagic problem8-patch2
194769xfce4-terminal window borders / decorations / widgets being incorrectly drawn (xubuntu 8.04)xfce4-terminalLowConfirmedPatch try #38-patch2
194531No video mode large enoughextremetuxracerUndecidedNewfix_screen_resolution.diffdiff
194487network-manager[-openvpn] doesn't handle properly routes pushed by OpenVPN 2.1_Rc7network-managerUndecidedConfirmednm-patches-bug-194487.tar.gzgz
194487network-manager[-openvpn] doesn't handle properly routes pushed by OpenVPN 2.1_Rc7network-manager-openvpnUndecidedConfirmednm-patches-bug-194487.tar.gzgz
192641Gdebi-gtk cannot use proxy with authenticationgksuLowIn ProgressReworked set_http_proxy_env patchpatch
192599GDM support for domain choicegdmWishlistTriagedgdm-2.8.0.7-domain-entry.patchpatch
192174Allow binary dumping to stdouttcpflowWishlistNew20_stdout-dump.diffdiff
192158iscsi checkfs and mountsysvinitWishlistNewcheckfs patchpatch
192158iscsi checkfs and mountsysvinitWishlistNewmountall.sh.patchpatch
192009gnome panel has no way to specify on which screen it should appeargnome-panelWishlistTriagedgnome-panel.diffdiff
191921Strange UI for Firefox 3.0b3gtk2-engines-cleaniceUndecidedConfirmedPatched src/cleanice-draw.cpatch
191921Strange UI for Firefox 3.0b3gtk2-engines-cleaniceUndecidedConfirmedWithout whitespacepatch
191849spread init script sets invalid conf file locationspreadLowConfirmedspread-init.diffdiff
191475[hardy] media tab in file management preferences missing applicationsexaileWishlistNewf-spot_0.4.1-4ubuntu4.debdiffdebdiff
191475[hardy] media tab in file management preferences missing applicationsexaileWishlistNewfspot_0.4.2-0ubuntu3.diffdiff
191251[needs-packaging] php5-embedphp5WishlistConfirmedPatch to enable building of the embed SAPIpatch
190371KDE3 libthai dynamic loading unneccessarily requires libtool archive filekdelibsUndecidedConfirmedFix the KHTML to use QLibrary instead of KLibLoader when loadind libthaitxt
189462slocate cron job fails if /etc/updatedb.conf not foundslocateHighConfirmedslocate_3.1-1.1ubuntu4~4.debdiffdebdiff
187138Feature request: Compatibility with Megapovpovray-3.6WishlistNewpatch for the megapov installer.diff
186049System.DllNotFoundException: libgalagolibgalagoUndecidedTriagedDebdiff for package maintainersdebdiff
186049System.DllNotFoundException: libgalagolibgalagoUndecidedTriagedPatch for galago-sharp/libgalago1.0-cildebdiff
185978init.d script not supporting option "status"fireholUndecidedConfirmeddebdiff debian-ubuntudebdiff
184017[Hardy]locking the firewall using Firestarter destabilises the entire X-ServerfirestarterUndecidedConfirmedfirestarter-wont-unlock.diffdiff
183456Trying to load a sf2 file with asfxload returns "sfxload: no memory left" awesfxUndecidedConfirmedawesfx-experiment.patchpatch
183076"enable bitmap caching" option in tsclient doesn't work properlytsclientUndecidedConfirmed17_fix_bitmap_caching_option.patchpatch
183076"enable bitmap caching" option in tsclient doesn't work properlytsclientUndecidedConfirmedtsclient_0.150-1ubuntu6~lp183076.debdiffdebdiff
183076"enable bitmap caching" option in tsclient doesn't work properlytsclientUndecidedConfirmedtsclient_0.150-1ubuntu7~lp183076.debdiffdebdiff
182999AcidRip Fails to properly work with x264 (includes patch).acidripWishlistConfirmedacidrip.pm x264/xvid supportpatch
182999AcidRip Fails to properly work with x264 (includes patch).acidripWishlistConfirmedacidrip_0.14-0.2ubuntu6.debdiffdebdiff
182999AcidRip Fails to properly work with x264 (includes patch).acidripWishlistConfirmedsignals.pm.patchpatch
180745cronolog doesn't support files larger than 2GBcronologUndecidedConfirmedpatch used in Gentoo and Fedoratxt
178701Searchmonkey crashes when a result is selectedsearchmonkeyUndecidedConfirmedsearchmonkey-fixes.patchpatch
178442Pulseaudio fails to initialize ICE1712 chipsetspulseaudioLowConfirmed90-pulseaudio.rules.patchpatch
177929Should autodetect filename character encoding in zip filesfile-rollerLowTriagedAutodetects our DOS charset. Requires libnatspec to be installed.patch
177929Should autodetect filename character encoding in zip filesfile-rollerLowTriagedPlease set manually windows_codepage (2nd line) to your DOS charset.patch
177929Should autodetect filename character encoding in zip filesfile-rollerLowTriagedp7zip-9.20.1-manual-iconv-lc_dos.patchpatch
177745Login Window Preferences: custom welcome message does not take effect.ubuntu-gdm-themesLowConfirmedPatched /usr/share/gdm/themes/Human/Human.xmlxml
177487Restart required dialogue issuesupdate-notifierLowTriagedFirst try to make main text look betterpatch
177487Restart required dialogue issuesupdate-notifierLowTriagedReplace gtk-yes with gtk-refresh as iconpatch
177000Rocklight deps?rocklightUndecidedIn Progressrocklight_0.1-2ubuntu1.debdiffdebdiff
176898Ubuntu Hardy / Jaunty system sounds and some other audio files are not properly playedpulseaudioUndecidedConfirmedCorrected sample sound fileszip
174229[hardy] fonts smaller after updatefontconfigUndecidedConfirmedEnable antialising for ttf-arphic-umingtxt
174016Middleclick on boomark openes the new tab in the backgroundepiphany-browserLowTriagedpatch to bring middle-clicked bookmarks up in an active new tabpatch
173799POSE gets "hardware exception #3" on startupposeLowConfirmedPatch to fix "Hardware exception #3" problemdpatch
173799POSE gets "hardware exception #3" on startupposeLowConfirmedpose-3.5-9.1ubuntu3.debdiffdebdiff
173799POSE gets "hardware exception #3" on startupposeLowConfirmedpose_3.5-9.1ubuntu2.diff.gzgz
172790html-helper-mode with ASP-files does not workhtml-helper-modeLowTriagedMake highlighting case insensitivepatch
172790html-helper-mode with ASP-files does not workhtml-helper-modeLowTriagedThis fixes the html-helper-mode speedbar problem when using asp-html-helper-modepatch
172790html-helper-mode with ASP-files does not workhtml-helper-modeLowTriagedThis fixes the visual-basic-mode invalid regular expression problempatch
171983Reduce SVG file size by removing unnecessary attributesinkscapeLowTriagedoptimize style="" attributes on save to reduce file sizepatch
171983Reduce SVG file size by removing unnecessary attributesinkscapeLowTriagedpreference to force/drop default style="" parts in svg outputpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged168658.v6.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.v10.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.v2.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.v3.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.v4.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.v5.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.v7.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.v8.patchpatch
171579Make inkscape remember dialogs window statusinkscapeWishlistTriaged171579.v9.patchpatch
171243implement clip-rule:evenoddinkscapeLowTriagedImplement loading and saving of clip-rulepatch
170225relative image paths instead of absoluteinkscapeMediumTriagedRelative path patchdiff
170225relative image paths instead of absoluteinkscapeMediumTriagedRelative path patch v2diff
170049Inverted ruler co-ordinate systeminkscapeMediumTriagedinvert-ruler-v1.diffdiff
165184amavisd-new + spamassassin: cronjob spams root useramavisd-newMediumTriagedno-bayes patch for amavisd-new-crontabno-bayes-patch
164544Error while join to domain (Unable to create machine account)smbldap-toolsUndecidedTriagedcorrects machine account creationpatch
163142graphviz should be built with gtk supportgraphvizWishlistConfirmedgraphviz_2.16-3ubuntu2_with-gtk.debdiffdebdiff
162797request for IPv6 supportdriftnetWishlistNewPatch for adding support for IPv6 and some cleanups.patch
162598missing headers in libtunepimp-devlibtunepimpWishlistNewtunepimp.h.patchpatch
162038netapplet icon shows wrong strength (always very low)netappletUndecidedIn ProgressDefinite fix for problem with netapplet wireless iconpatch
162038netapplet icon shows wrong strength (always very low)netappletUndecidedIn ProgressFix for problem with netapplet wireless iconpatch
162038netapplet icon shows wrong strength (always very low)netappletUndecidedIn Progressdebdiff version of the fix.debdiff
161189diff -u -U 0 results in diff -U 3diffutilsUndecidedConfirmeddiff.c.patchpatch
160893usplash progress bar should go backwards during uswsusp suspenduswsuspLowNewWorking patch, built on the patch from bug 114688gz
160667The option for 'rewriteDomain' is not set from debconf.ssmtpUndecidedNewPatch to remove 'parameter commenting if not set'.diff
160667The option for 'rewriteDomain' is not set from debconf.ssmtpUndecidedNewSet "FromLineOverride" parameter to the default value.diff
160520scanbuttond package doesn't have an init script [patch included]scanbuttondUndecidedConfirmedInitscript for scanbuttondscanbuttond
160264[nvidia] compiz displays white screen when lockedgnome-screensaverMediumNewdebdiff to disable screensaver patch to compizdebdiff
159691(patch) adding goom2k4 to libvisual-pluginslibvisual-pluginsWishlistNewFirst Public Attempt Debdiffgz
159338Re: Heads-up: small xine-lib transition in hardyoxineUndecidedIn Progressxine-plugin_1.0.2-1ubuntu3.debdiffdebdiff
159338Re: Heads-up: small xine-lib transition in hardyxine-pluginUndecidedIn Progressxine-plugin_1.0.2-1ubuntu3.debdiffdebdiff
159026Lenovo Thinkpad x41 Tablet and X60 Tablet and X200 Tablet rotate eventsacpi-supportMediumConfirmedDebdiff for the changes outlined abovedebdiff
158976Casper doesn't wait for USB hard disks to come up (persistent)casperMediumConfirmedSleep a while to make sure all usb devices are up and runningpatch
158784Typo in the translation makes cowbell writing wrong titlescowbellUndecidedTriagedcowbell.fixfix
158784Typo in the translation makes cowbell writing wrong titlescowbellUndecidedTriageddiffgz+dsc+fix.tartar
156085Could not open /proc/bus/usb/devicesusbviewMediumTriaged156085-b.debdiffdebdiff
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedPatch to kvm-77 to allow USB passthrough with qemupatch
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedQEMU (KVM) USB sys-fs supportpatch
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedRebased qemu -1ubuntu2 Hardy debdiffdebdiff
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedkvm -4ubuntu3 gutsy-proposed debdiffdebdiff
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedkvm -4ubuntu3 hardy debdiffdebdiff
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedqemu -2ubuntu5 gutsy-proposed debdiffdebdiff
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedqemu -2ubuntu5 hardy debdiffdebdiff
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedusbview: Debdiff for Hardy [incorrect]diff
156085Could not open /proc/bus/usb/devicesusbviewMediumTriagedusbview: Debdiff for gutsy-proposed [incorrect]diff
153768External SATA (eSATA) removable disk not auto mountedudisksMediumTriaged0001-PATCH-Export-ahci-eSATA-attribute.patchpatch
152808g-p-m always try to set the main policy to 'ondemand'gnome-power-managerLowNewFix default Policydiff
152438ViewVC doesn't work after dist-upgrade from viewcvs in feistyviewvcMediumConfirmed1.1-dev-20070605.patchpatch
152438ViewVC doesn't work after dist-upgrade from viewcvs in feistyviewvcMediumConfirmedviewvc-conf-fixed.patchpatch
150690Can't drag a window to another workspacelibwnckWishlistTriagedbetterpatch.diffdiff
150690Can't drag a window to another workspacelibwnckWishlistTriagedhackpatch.diffdiff
150461smarty-gettext installs plugins to the wrong locationsmarty-gettextUndecidedConfirmedsmarty-gettext.patchpatch
150443No workspace switching with mousewheel with compizgnome-panelWishlistTriagedDisable scrolling in workspace switching and enable with gconfdiff
150205Make menu items labels more consistent and cleargnome-power-managerLowTriagedPatch against /usr/share/applications/restricted-manager.desktopdiff
150205Make menu items labels more consistent and cleargnome-power-managerLowTriagedPatch against /usr/share/applications/update-manager.desktopdiff
149236Make hellanzb provide unrar functionality by defaulthellanzbUndecidedConfirmedhellanzb nounrar patchpatch
148005rpmstrap, centos4 package names mismatchrpmstrapUndecidedConfirmedcentos4 hackpatch
145923no HD-DVD support in Ubuntugstreamer0.10WishlistTriagedUDF_2.50-linux-2.6.22-rc4+.patch.bz2bz2
145923no HD-DVD support in Ubuntugstreamer0.10WishlistTriagedeac3v2.patchpatch
145801sometimes doesn't detect main title - patch includedmplayerUndecidedConfirmedautodetect main dvd title based on maximum lengthdiff
145801sometimes doesn't detect main title - patch includedmplayerUndecidedConfirmedupdated patchdiff
145523umountnfs should umount dependent dirssysvinitWishlistConfirmedumountnfs-ubuntu.diffdiff
145461Image is lost with CompositexteddyUndecidedConfirmedFix for xteddy with Compositepatch
145380pam_env should document per-user environment file ~/.pam_environment more clearlypamWishlistTriagedDEBDIFFDEBDIFF
144431gethostbyname() cant resolve names starting/ending with "-"glibcLowConfirmed2011-09-02-ubuntu-bug-144431.patchpatch
139674bash completion doesn't perform filename processing for ssh -ibash-completionLowTriagedpatch to ssh bash completionpatch
139514raid10 support should be added to installermdcfgWishlistIn ProgressAdd RAID10 support (without placement options though)patch
138957(gutsy) lock screen doesn't support fingerprint readers driven by thinkfingerthinkfingerUndecidedNewudev rule that allows gnome-screensaver to access thinkfingerrules
138654Annoying and useless delays on password entry errorspamWishlistTriagedThis patch changes the aggrivating 2 second delay to a more pleasant 0.5 seconds. Place this in debian/patches-applied/ and add to debian/patches-applied/seriespatch
137854vim-gnome window does not resize correctly when opening the 1st tabvimLowTriageddiffdiff
137136no way to configure update-grub not to set 'quiet' option in menu.lst non-recovery stanzasgrubWishlistConfirmedPatch to the source package.patch
136450dotedit not working for graphviz-cairographviz-cairoUndecidedConfirmeddotedit-use-xlib.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0001-map-rebuild-map-if-it-doesn-t-exist.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0002-maps-Fix-bugs-in-map_read.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0003-mapfile-fix-bug-in-testing-for-var-run-mdadm.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0004-mapfile-allow-the-path-name-to-the-device-to-be-empt.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0005-mapfile-Fix-off-by-one-error-in-RebuildMap.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0007-fix-add_dev-handling-of-broken-links.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0008-Fix-an-error-when-assembling-arrays-that-are-in-the-.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0009-Adjust-major-number-testing-to-allow-for-extended-mi.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0010-mapfile-when-rebuilding-choose-an-appropriate-name-i.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0012-Incremental-lock-against-multiple-concurrent-additio.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0013-Add-locks-for-Manage_runstop.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0014-Bug-fixing-for-mdadm-map-file-reading-and-dev-name-c.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0015-Partition-creation-logic-fixing.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0017-Fixed-locking.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0018-Initramfs-to-set-hostname-for-autoassembly.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progress0019-Always-set-homehost-if-not-specified.patchpatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn ProgressAdding this code renaming patch, to make the porting of the rest of the patches from Neil Brown's repository easy.patch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progressinitramfs change to set the hostnamepatch
136252[->UUIDudev] mdadm.conf w/o ARRAY lines but udev/mdadm not assembling arrays. (boot & hotplug fails)mdadmMediumIn Progressmdadm_lp_bug_fixes.debdiffdebdiff
135812can't add files to mounted volume, no free space sony Z610iobexfsUndecidedConfirmedReport memory usage statistics of N70patch
135624libapache2-mod-php5 should provide LAMP test pagephp5WishlistConfirmeddebdiff against 5.2.3-1ubuntu5debdiff
135624libapache2-mod-php5 should provide LAMP test pagephp5WishlistConfirmeddebdiff against 5.2.3-1ubuntu6debdiff
134795GSAMBAD switches User and Password match levelsgsambadUndecidedConfirmed05-match-level-fix.dpatchdpatch
133623ndisgtk doesn't work with a file name with space (in the tree and/or in the filename)ndiswrapperUndecidedConfirmedpatch-blank-reload.txttxt
133520Patch to auto-mount LUKS key-file encrypted volumesgnome-mountLowTriagedHAL respects mapping path in /etc/crypttabpatch
133520Patch to auto-mount LUKS key-file encrypted volumesgnome-mountLowTriagedgnome-mount crypto key-file supportdiff
133520Patch to auto-mount LUKS key-file encrypted volumeshalLowTriagedHAL respects mapping path in /etc/crypttabpatch
133520Patch to auto-mount LUKS key-file encrypted volumeshalLowTriagedgnome-mount crypto key-file supportdiff
133371"Composite extensions not available" message windows can't be closeddesktop-effectsUndecidedConfirmedThis should fix it.patch
132802"return" missing in ImpactPacket.TCPOptions.get_ts_echoimpacketUndecidedIn Progress01_ImpactPacket_TCPOption_get_ts_echo.patchpatch
132417evince doesn't display the correct fontfontconfigUndecidedNewArialMT fixpatch
131389grub should "silently succeed"grubWishlistConfirmedPatch to disable GRUB notifications and make it silently succeed. Error messages still get displayed.patch
131281dgen crashed with SIGSEGV in __libc_start_main()dgenWishlistConfirmedBetter version of patchpatch
131281dgen crashed with SIGSEGV in __libc_start_main()dgenWishlistConfirmedChanges to configure.in for dgen to compile on x86_64patch
131281dgen crashed with SIGSEGV in __libc_start_main()dgenWishlistConfirmedPatch to make MZ80 64-bit cleanpatch
131205avahi-discover crashed with Error in setlocale()avahiLowTriagedServiceTypeDatabase.py.diffdiff
131017xshogi leaves gnushogi running after exitgnushogiUndecidedIn ProgressPatch to fix xshogi/xshogi.c and xshogi/xshogifn.hpatch
130334xvncviewer support broken by new version 4.1.1service-discovery-appletUndecidedConfirmed*MINIMAL* patch to make service-discovery-applet work again, using vinagreservice-discovery-applet-vinagre
130334xvncviewer support broken by new version 4.1.1service-discovery-appletUndecidedConfirmedMads Chr. Olesen's patch in debdiffpatch
130334xvncviewer support broken by new version 4.1.1service-discovery-appletUndecidedConfirmedpatch w/ fixed changelogpatch
130334xvncviewer support broken by new version 4.1.1service-discovery-appletUndecidedConfirmedxvnc4viewer-sda.patchpatch
128727Readline library crash on custom completionreadline5UndecidedTriagedDelete matches and set to NULL if no match, to avoid segfault.patch
126618gnome-system-monitor does not display hd reads to fake-raidgnome-system-monitorLowTriagedlibgtop2 fsusage.c patchpatch
125918[Gutsy Tribe 2, Intrepid Alpha 2+] Illuminated keyboard not working on MacBook Pro rev.3 (santa rosa)halUndecidedNewpatch 1/3patch
125918[Gutsy Tribe 2, Intrepid Alpha 2+] Illuminated keyboard not working on MacBook Pro rev.3 (santa rosa)halUndecidedNewpatch 2/3patch
125918[Gutsy Tribe 2, Intrepid Alpha 2+] Illuminated keyboard not working on MacBook Pro rev.3 (santa rosa)halUndecidedNewpatch 3/3patch
125918[Gutsy Tribe 2, Intrepid Alpha 2+] Illuminated keyboard not working on MacBook Pro rev.3 (santa rosa)pommedUndecidedNewpatch 1/3patch
125918[Gutsy Tribe 2, Intrepid Alpha 2+] Illuminated keyboard not working on MacBook Pro rev.3 (santa rosa)pommedUndecidedNewpatch 2/3patch
125918[Gutsy Tribe 2, Intrepid Alpha 2+] Illuminated keyboard not working on MacBook Pro rev.3 (santa rosa)pommedUndecidedNewpatch 3/3patch
125702casper-rw fs not cleanly unmounted on persistent live USB shutdowncasperHighTriagedExpose /cow and mount it r/o on shutdowndiff
125702casper-rw fs not cleanly unmounted on persistent live USB shutdowncasperHighTriagedexpose mount points and remount aufs root r/o on shutdowndiff
125702casper-rw fs not cleanly unmounted on persistent live USB shutdowncasperHighTriagednew-casper.diffdiff
125317html-helper-mode has a reserved keybindinghtml-helper-modeUndecidedConfirmed0001-Changed-all-entity-keys-to-use-C-cC-c.patchpatch
123920Bluetooth Logitech Dinovo Keyboard/Mouse don't workbluezMediumTriagedhid2hci.patchpatch
122897Some grammar issueshubackupLowTriagedPatch against bzrdiff
122897Some grammar issueshubackupLowTriagedbzr bundlediff
121788Assertion "_width>=0" failedaptitudeUndecidedConfirmedaptitude.patchpatch
121279Totem playback choppy with H264gstreamer0.10-ffmpegLowTriagedgstffmeg.patchpatch
121279Totem playback choppy with H264gstreamer0.10-ffmpegLowTriagedubuntu-gst-timestamp.patchpatch
120363NetworkManager should support smartcard based certificatenetwork-managerHighTriagedlp120363_smartcard_pkcs11.patchpatch
120363NetworkManager should support smartcard based certificatenetwork-managerHighTriagedupdated patch for smartcard support in NM 0.7patch
120152"Permission Denied" when archiving from /var/mail directoryarchivemailUndecidedConfirmedSuggested Patchgz
120049header_postinst_hook should use /etc/kernel/header_postinst.d insteadkernel-packageMediumConfirmedheader.patchpatch
119821dh_make does not follow blueprintdh-makeWishlistTriagedDebdiff to make dh-make more Ubuntu developer friendlydebdiff
119821dh_make does not follow blueprintdh-makeWishlistTriagedMaintainer field patchpatch
118605[fglrx] freezes upon Logout or Switch user [patch]linux-restricted-modules-envy-2.6.24UndecidedIn Progressauthatieventsd.patchpatch
117514seahorse does not synchronize keys with keyserverseahorseLowConfirmedthis patch should do the trikpatch
115773ipv6 disabledpsiWishlistConfirmedDefine NO_NDNSdiff
114815Can't set (for me) important partition optionsgnome-mountLowTriagedadd gid to 20-storage-methods.fdidiff
114815Can't set (for me) important partition optionshalLowTriagedadd gid to 20-storage-methods.fdidiff
114803No mechanism for per-kernel configuration files during early bootmodule-init-toolsWishlistTriaged0001-Added-mechanism-for-per-kernel-version-module-option.patchpatch
114688uswsusp does not depend on libusplash0uswsuspUndecidedConfirmeduswsusp_0.6~cvs20070618-1ubuntu3.debdiffdebdiff
113095nfs timeout on shutdownnetwork-managerUndecidedIn ProgressFix to prevent NetworkManager being prematurely killedpatch
113092nautilus in feisty can't open http:// URI which affects service-discovery-appletservice-discovery-appletLowConfirmedPatch to use firefox instead for HTTP/HTTPS resources. NOT A COMPLETE FIX!py-patch
112955vino (vnc) keyboard mapping problemvnc4UndecidedConfirmeddebdiff for updatedebdiff
112955vino (vnc) keyboard mapping problemvnc4UndecidedConfirmedpatched used to fix the bugpatch
112248fields to set MTU and MSS missingnetwork-manager-openvpnWishlistTriagedfragmentation_options.patchpatch
112248fields to set MTU and MSS missingnetwork-manager-openvpnWishlistTriagedfragmentation_options_lucid.patchpatch
112248fields to set MTU and MSS missingnetwork-manager-pptpWishlistTriagedfragmentation_options.patchpatch
112248fields to set MTU and MSS missingnetwork-manager-pptpWishlistTriagedfragmentation_options_lucid.patchpatch
112248fields to set MTU and MSS missingnetwork-manager-vpncWishlistTriagedfragmentation_options.patchpatch
112248fields to set MTU and MSS missingnetwork-manager-vpncWishlistTriagedfragmentation_options_lucid.patchpatch
110144No lo interface after debootstrap installdebootstrapWishlistTriagedFix the formatting of the gutsy rulespatch
110144No lo interface after debootstrap installdebootstrapWishlistTriagedetc_files.patchpatch
108951Gnome drawer applet delays and unresponsivenessgnome-panelLowTriagedgnome-panel.drawer.patchpatch
107025Multipage printing issue using even and odd.gtk+2.0LowTriagedpatch against evince 2.26.1-0ubuntu1 to use sheets not pagespatch
106197nload average function files with high bitratesnloadWishlistConfirmedstatus.cpp.diffdiff
106097EVMS Boot-ProblemevmsHighTriagedPatch for evms to solve the above mentiond boot-problemdiff
105900[Upstream] Bold, Italics, and Bold Italics not in English on Fonts menufontconfigHighTriagedPatch against libs-gui/vcl/unx/source/fontmanager/fontconfig.cxx.patch
105082Pressing "Esc" in main window should minimize, not try to quit.gstmWishlistConfirmedpatch to minimize instead of quitpatch
105040libkdtree++-dev does not compile with g++-4.0libkdtree++UndecidedConfirmedlibkdtree-gcc43.patchpatch
103929Bash prompt string looks for xterm-color, gnome terminal identifies as xtermbashWishlistConfirmedbashrc.diffdiff
102128Notification daemon leaks X11 windowsnotification-daemonUndecidedConfirmed01_ubuntu_theme.patchpatch
102128Notification daemon leaks X11 windowsnotification-daemonUndecidedConfirmed02_make_ubuntu_theme_default.patchpatch
102128Notification daemon leaks X11 windowsnotification-daemonUndecidedConfirmed03_fix_xinerama.patchpatch
102128Notification daemon leaks X11 windowsnotification-daemonUndecidedConfirmed04_fix_xinerama_in_theme_c.patchpatch
102128Notification daemon leaks X11 windowsnotification-daemonUndecidedConfirmed05_dont_crash_on_critical_warnings.patchpatch
102128Notification daemon leaks X11 windowsnotification-daemonUndecidedConfirmed06_fix_ubuntu_theme_resources_leaks.patchpatch
102128Notification daemon leaks X11 windowsnotification-daemonUndecidedConfirmedThis patch fixed the leak for me.diff
99978gnome-terminal has no ability to disable close button on tabsgnome-terminalWishlistTriaged1diff
99978gnome-terminal has no ability to disable close button on tabsgnome-terminalWishlistTriagedschema diffdiff
99978gnome-terminal has no ability to disable close button on tabsgnome-terminalWishlistTriagedterminal-tab-label.c.patchpatch
99949udevd crashed with SIGSEGV in _fini()libselinuxMediumConfirmedlibselinux1_patchlibselinux1_patch
99437umount: mount disagrees with the fstabutil-linuxUndecidedConfirmedPatch for fixing user uuid unmountingpatch
99111White text unreadable on popupgmail-notifyUndecidedConfirmedPatch to add 'use dark background' optiongz
98733Interactive digest and basic authentication for apt-getaptWishlistConfirmedinteractive and digest http authentication patchdiff
96251semantic.sty: Command \@temp already definedtexlive-extraUndecidedConfirmedRemoves \newcommand{\@temp}diff
95368"Cannot remove directory" on unmount due to stale .hal-mtab entrieshalLowTriagedSkip stale entries in /media/.hal-mtabpatch
94752Startup notification doesn't work when gaim is started without a window (only in the notification area).pidginUndecidedConfirmedfixpatch
93360Dhcdbd doesn't recognize permanent (-1) DHCP leasesdhcdbdMediumConfirmedPartial workaround for dhcdbd/Network Manager interaction problem.patch
93050gnome-vfs2-2.18.0.1 is confused by mount -o bind entriesgnome-vfs2LowConfirmedfix for mount bind doublon testpatch
92660ltsp-manager crashed with TypeError in get_videodrivers()ltsp-managerMediumConfirmedfix for /usr/lib/python2.5/site-packages/ltsp/dictionary.pypatch
92028xchat does not do composite transparency, crashes if transparency is enabled with GTK RGBAxchatWishlistTriaged23_rgba_transparency.patchpatch
92028xchat does not do composite transparency, crashes if transparency is enabled with GTK RGBAxchatWishlistTriagedxchat-gnome_0.26.1-1ubuntu3.dsc.diffdiff
91867[PATCH] allow resume from LUKS encrypted swap partitioninitramfs-toolsWishlistNewresume from LUKS encrypted swap patchLUKSResumePatch
91559prelude-manager install scriptprelude-managerUndecidedIn Progressprelude-manager.postinst.diffdiff
90851Firefox does not set KDE wallpaperfirefox-3.0WishlistConfirmedKDEBackground.diffdiff
90851Firefox does not set KDE wallpaperfirefox-3.0WishlistConfirmedupdated patchdiff
90681resolv.conf overwritten using VPN/PPP etc...dhcp3MediumConfirmeddhclient-script.patchpatch
90681resolv.conf overwritten using VPN/PPP etc...dhcp3MediumConfirmedubuntu 7.10 dhcp3-client vpn patchpatch
89233restricted-extras should pop up a notification to restart Firefoxsun-java5WishlistConfirmedDebdiff against flashplugin-nonfree_9.0.48.0.0ubuntu3debdiff
87611Portmap does not recognize IP 127.0.1.1 as a local IP addressportmapUndecidedNewPatch to recognize 127.x.x.x as local IP adressesdiff
87611Portmap does not recognize IP 127.0.1.1 as a local IP addressportmapUndecidedNewportmap_6.0.0-1ubuntu2.debdiffdebdiff
86843modifying PAM configuration could break gksugksuMediumConfirmedDifferent promtpt for terminal and graphic environmentpatch
86184Can't change cursor style using Compiz.compizMediumConfirmedAdd cursor theme supportpatch
86184Can't change cursor style using Compiz.compizMediumConfirmedAdd cursor theme support configure and Makefile.in diffpatch
86184Can't change cursor style using Compiz.compizMediumConfirmeddebdiffdebdiff
84767feisty joystick problemsnes9expressUndecidedConfirmedsnes9express patch for input and joydev changespatch
84306Crash on closing active tabsgtk+2.0MediumTriagedcheck_pointers.patchpatch
83922gdesklets does not startgdeskletsMediumTriagedgdesklets_0.36-5build1ubuntu1.debdiffdebdiff
83922gdesklets does not startgdeskletsMediumTriagedgdesklets_0.36-5ubuntu1.debdiffdebdiff
83880EVMS reports incorrect XFS stripe unit and width sizes.evmsMediumTriagedXFS stripe reporting patch for EVMS 2.5.5patch
82853Add support for the smbk5pwd overlayopenldapWishlistTriagedBuild the smbk5pwd overlay in the precise package.patch
82853Add support for the smbk5pwd overlayopenldapWishlistTriagedsmbk5pwd-fix.patchpatch
82720ping doing LOTS of useless dns requestiputilsLowConfirmedpatch of the modificationdiff
82283[feisty] no graphical progressbar in uswsuspuswsuspWishlistConfirmedpatch for /etc/acpi/hibernate.sh to work with uswsusp-0.3~cvs20060928-6ubuntu3diff
80921No subpixel renderingpopplerLowTriagedpoppler-force-subpixel.patchpatch
80485Special keys don't work on Acer TravelMate C310hal-infoUndecidedTriaged30-keymap-acer.fdi.diffdiff
78455DEFECT in checkinstall: abort due to missing file or directorycheckinstallMediumTriagedTurn off file system translation by defaultpatch
78043udev stops pppd persist workingifupdownUndecidedConfirmedUnbreak network hotpluggingpatch
77934using padding (all) dialog box - program crashcssedMediumIn Progresscssdialogs-functions.c.diffdiff
76933Docbook2man fails on directories with spacesdocbook-utilsUndecidedConfirmedFixes quoting bugpatch
76449Cannot sort static playlistsrhythmboxLowTriagedFix.debdiffdebdiff
75090Patch for previously unsupported chipsetmgettyWishlistConfirmedThe patchdiff
74764Fruit doesn't respond to simple UCI 'go' commandfruitUndecidedIn ProgressPatch to enable simple go and default to search depth 5patch
74699libsoftbeep strips BELs inappropriatelysoftbeepUndecidedConfirmedworkaround: don't write if long_desc is an empty stringdiff
74065apt-get remove vmware-player doesn't remove vmware-player servicevmware-playerUndecidedConfirmedvmware-player.postrm.patchpatch
71754Trying to install the character "é" fails with vim-latexsuitevim-latexsuiteUndecidedConfirmedfix e-acutedpatch
71292plugin `check_radius' is in two non-conflicting packagesnagios-plugins-extraUndecidedConfirmedthis should fix the latest move (not sure about the other problems mentioned here)debdiff
71017Seek on DVD not performed relative to titlegst-plugins-ugly0.10LowConfirmedFixes "Seek on DVD not performed relative to title"patch
70566"Eject CD" message not translatedcasperWishlistTriagedGuadalinex patch for the casper i18n supportpatch
70566"Eject CD" message not translatedcasperWishlistTriagedMake casper exit message translatable (plymouth)patch
69226Cyrillic supportproftpdUndecidedConfirmeddpatchdpatch
69226Cyrillic supportproftpdUndecidedConfirmedpatchgz
69023ppscsi won't build with module-assistant under kernel 2.6.17-10-generic (or newer)ppscsiUndecidedConfirmedPatch to make ppscsi-beta2-20060424 compile on linux 2.6.24diff
67473backup to non-existing directory failshubackupLowConfirmedsmall patchpatch
66952esddsp not support SNDCTL_DSP_CHANNELS ioctl.esoundWishlistConfirmedpatch to support SNDCTL_DSP_CHANNELSdiff
66623warning: GRClosure invoking callback: already destroyedruby-gnome2LowConfirmedPatch for libglade2.rb to fix bug #66623patch
66231Mistakes in scim-tables stringsscim-tablesMediumConfirmedpatch to fix stringspatch
64597Mistakes in gftp stringsgftpLowTriagedChanges: 'an URL' -> 'a URL'diff
64597Mistakes in gftp stringsgftpLowTriagedChanges: transfering -> transferringdiff
64597Mistakes in gftp stringsgftpLowTriagedfixes: 'transfered' -> 'transferring'diff
64597Mistakes in gftp stringsgftpLowTriagedgftp_2.0.18-17ubuntu2.debdiffdebdiff
64301Unable to unlock screen when using ldapgnome-screensaverMediumConfirmedPatch relating to PAM from CentOS5 SRPMpatch
64064would be nice to add ~/bin to the default PATHpamWishlistConfirmedpam.64064-b.debdiffdebdiff
64064would be nice to add ~/bin to the default PATHpamWishlistConfirmedpam.64064.debdiffdebdiff
63515Typo in skim-scim-pinyin stringscim-pinyinLowConfirmedscim-pinyin_0.5.91-0ubuntu13.debdiffdebdiff
63195[patch] Mistakes in subversion stringssubversionWishlistNewPatch against subversion-1.6.6dfsgpatch
63195[patch] Mistakes in subversion stringssubversionWishlistNewpatch to fix stringspatch
61760clutters console with messages during normal worklsbLowConfirmedproposed patch to make logging to console configurablepatch
60448.xsession_errors file grows out of control & saturates disk spacegdmLowTriagedRevert to previous overwrite behaviourpatch
60448.xsession_errors file grows out of control & saturates disk spacegdmLowTriageddapper debdiffdiff
60448.xsession_errors file grows out of control & saturates disk spacegdmLowTriageddon't overwrite symlinks as symlinks, instead overwrite their destinationdiff
60448.xsession_errors file grows out of control & saturates disk spacegdmLowTriagededgy debdiffdebdiff
60448.xsession_errors file grows out of control & saturates disk spacegdmLowTriagedlog xsession errors in /dev/nullpatch
59020Typos in scim-pinyin stringsscim-pinyinUndecidedConfirmed20_fix-typo.dpatchdpatch
59020Typos in scim-pinyin stringsscim-pinyinUndecidedConfirmedscim-pinyin_0.5.91-1ubuntu3.debdiffdebdiff
57797include aoTuV patchlibvorbisWishlistConfirmedlibvorbis_1.2.0.dfsg-2ubuntu1~ppa1.debdiffdebdiff
56125apt-get moo doesn't look like a cowaptWishlistConfirmedAPT with super cow configpatch
56125apt-get moo doesn't look like a cowaptWishlistConfirmedPatch to replace default apt-super-cow with Fernando Ribeiro's improved apt-super-cow.gz
55850implement some kernel network security featuresprocpsWishlistTriagedsysctl.conf diff to implement all everythingdiff
53887[patch] Command completion should be enhancedbashWishlistConfirmedCleaner diff against bash 3.2diff
53407SCIM help dialogue for scim-skk is in Japanesescim-skkLowTriageddpatch file debian/patches/20_i18n-help.dpatch which should fix this bugdpatch
52189Does not apply cleanly to ubuntu linux-source-2.6.15kernel-patch-vserverUndecidedConfirmedResulting Vserver-Patch for linux-source-2.6.15vspatch
51774ssh -X fails without warning when xauth not installedopensshWishlistConfirmedopenssh_4.7p1-4ubuntu2.debdiffdebdiff
51106Calculations by "date" are wrongcoreutilsUndecidedTriagedgetdate_5_timerelsignedoffset.patchpatch
49627macro gh_init from /usr/include/guile/gh.h has a syntax errorguile-1.6LowConfirmedA patch that fixes the problemdiff
48407unmounting broken, mounting for normal userslibpam-mountMediumConfirmedpatch to /usr/bin/mount.crypt and /usr/bin/umount.cryptpatch
48262[users-admin] users & groups: should have some mention than a session restart is required to apply a group changegnome-system-toolsWishlistTriagedPrompt message that reboot is needed and give the user the options to restartpatch
48146Poor font rendering in okularpopplerLowConfirmeddisable freetype's autohinting when anti-aliasingpatch
47516CDROM drive eject disc after randomly seconds of usehalMediumConfirmedaddon-storage-detailed-buffer.patchpatch
46029Add support for autotools-devgnome-commonWishlistConfirmedProposed patchpatch
45544Notifications overlap the bottom panel.notification-daemonLowConfirmedReplacement patch for 03_fix_xinerama_stackdiff
44609RAID not implemented (use alternate CD instead)ubiquityWishlistConfirmedmdadm_2.6.7.1-1ubuntu13.debdiffdebdiff
43730inkscape 'export bitmap' dialog should indicate success and close after exportinkscapeWishlistTriagedexport reports to status bardiff
43730inkscape 'export bitmap' dialog should indicate success and close after exportinkscapeWishlistTriagedinkscape-r9299.diffdiff
43730inkscape 'export bitmap' dialog should indicate success and close after exportinkscapeWishlistTriagedinkscape-r9300.diffdiff
43569Needs Ubuntu-style init scriptsetserialWishlistConfirmedPatch to use log_action_begin_msg etc. in init scriptpatch
43369remove default settings from glade files while building deb files.libglade2WishlistNewthis patch ignores * in glade files and sticks to the system default.patch
43066Window list behaves bad when panel is vertical.gnome-panelMediumIn ProgressFix Task List Orientation Vertical Flickerpatch
43066Window list behaves bad when panel is vertical.gnome-panelMediumIn Progressvertical.patchpatch
43066Window list behaves bad when panel is vertical.libwnckMediumIn ProgressFix Task List Orientation Vertical Flickerpatch
43066Window list behaves bad when panel is vertical.libwnckMediumIn Progressvertical.patchpatch
42686audioscrobbler password saved as plaintext in gconfrhythmboxMediumTriagedrhythmbox-md5passwd-2.patchpatch
42100Fix the wrong device registered in netstatus applet, and automatically set it to the first working network connection.gnome-netstatusWishlistTriagedThe better version, w/ typo fixed.sh
40553DejaVu Sans LGC should be availablettf-dejavuWishlistConfirmedttf-dejavu_2.14-2ubuntu1.debdiffdebdiff
40285libgcc_s.so.1 must be installed for pthread_cancel to workgcc-4.4UndecidedConfirmedFixes compile error with Siege 2.70patch
39328Disable scrolling on window list to flip through windowslibwnckWishlistTriagedAdds gui for changing scrolling behaviourpatch
39328Disable scrolling on window list to flip through windowslibwnckWishlistTriagedAdds scroll_enabled property to tasklist in libwnckpatch
39328Disable scrolling on window list to flip through windowslibwnckWishlistTriagedChange the scroll_enabled property via gconf settingsdiff
39328Disable scrolling on window list to flip through windowslibwnckWishlistTriageddebdiff karmicdebdiff
39328Disable scrolling on window list to flip through windowslibwnckWishlistTriageddebdiff karmic (option edition) v1debdiff
39210installer: cannot set mount option data=journalpartman-ext3WishlistConfirmedpatch to support data={journal,ordered,writeback}, acl, and noauto mount options for ext{3,4}debdiff
38917ip-up.d/0000usepeerdns shouldn't clobber /etc/resolv.conf (patch attached)pppMediumConfirmedFIXED patchpatch
38917ip-up.d/0000usepeerdns shouldn't clobber /etc/resolv.conf (patch attached)pppMediumConfirmedPatch to fix clobber of /etc/resolv.conf nameserverspatch
38022run-parts doesn't run script with sh extensionanacronLowTriagedpartial fix for Issue #38022diff
35167double-clicking a date should start evolution on the right daygnome-panelLowConfirmedStart evolution on the correct daypatch
34813gedit fails to save files over smbfs/cifsgeditLowTriaged0001-smbfs-sshfs-save-problem.patchpatch
34643Live CD can be inadvertently ejected via hotkeycasperMediumConfirmedFirst attempt at disabling Eject hotkey on Live CDpatch
34181locale and charset problem in mysql - default character set should be set to utf8mysql-dfsg-5.1WishlistTriagedpatch to mysql.cnfdiff
32484selection should default to free spacegpartedWishlistTriagedUnallocated Space selected on refreshpatch
32415Apple Bluetooth Mouse and Keyboard pairing broken in Dapper/Edgy/Feistybluez-utilsUndecidedNewfixes bluez-utils "hidd" for ppc64 platformpatch
32398Boot splash screen always disappears at reiserfs check.reiserfsprogsLowConfirmedpatch to increase timeout of checkfs.sh while using reiserfspatch
30554rhythmbox columns are not in "right" orderrhythmboxWishlistIn Progresspatchpatch
30228init script is brokengsmlibMediumIn Progressgsmlib-init.patchpatch
29787Backspace key in GNU Screen not detected correctlyvteLowConfirmedDebdiff (hardy)debdiff
29787Backspace key in GNU Screen not detected correctlyvteLowConfirmedDebdiff (intrepid)diff
29035An error which shouldn't be displayed (anymore)gdesklets-dataMediumConfirmednotes.displaydisplay
27172[patch] install to pcmcia-connected disk can't find rootinitramfs-toolsLowConfirmedconditionally adds pcmcia _and_ yenta-socketpcmcia
27172[patch] install to pcmcia-connected disk can't find rootinitramfs-toolsLowConfirmedhook-functions with pcmcia¥ta-socket added to default modulesdiff
27171[network-admin] non-ASCII WLAN SSID breaks network-admingnome-system-toolsLowTriagedfixes scanning for drop-down menu of networkspatch
26633Cannot move cross-filesystem symlinks to Trashgnome-vfs2MediumTriaged34_delete_symlink_across_filesystem.patchpatch
26633Cannot move cross-filesystem symlinks to Trashgnome-vfs2MediumTriagedPatch frol Christian Neumairpatch
26058after boot into Windows XP, grub menu is not displayed and computer rebootgrubHighConfirmedDirect Stage1 to Stage2 Link when doing grub-installpatch
19053Synaptic doesn't respect gnome preferencessynapticWishlistConfirmedRespect system toolbar prefrencediff
18995[MASTER] "Open With" dialog not user-friendlyfirefoxLowTriagedforce-system-integration-with-xdg-open.patchpatch
18995[MASTER] "Open With" dialog not user-friendlyfirefox-3.5LowConfirmedforce-system-integration-with-xdg-open.patchpatch
18995[MASTER] "Open With" dialog not user-friendlymozilla-thunderbirdUndecidedConfirmedforce-system-integration-with-xdg-open.patchpatch
18572modem_applet: waitpid()'s return value causes wedging.gnome-appletsMediumTriagedPatch that outputs the error condition patch
18384Wording of keyring access dialog could be improvedgnome-keyringLowTriagedCorrected patchdiff
18384Wording of keyring access dialog could be improvedgnome-keyringLowTriagedRough patchdiff
16953Aptitude: should accept both "Si" and "Sí" (when asking for confirmation)aptitudeLowIn Progress0001-I18n-deficiency-in-cmdline-untrusted-prompt.patchpatch
15495"Archive Manager" doesn't mean anything if you don't know what an "archive" isfile-rollerWishlistTriagedupdate with the suggested changespatch
14261Shouldn't say "Need to get 0B"aptWishlistConfirmedapt-get_0B_fetch.patchpatch
14044Fullscreen display split between screens with Xinerama/MergedFBlibsdl1.2MediumConfirmed301_xinerama-sort-of-working.diffdiff
13754Make or-pkgs possible (totem|totem-xine)gnome-app-installWishlistConfirmedPatch by Mikko Virkkilädiff
10686No GUI method to disable screen lock on lid close eventgnome-power-managerLowConfirmedPatch to fix this bugpatch
8422Error message on ending VNC sessiontsclientMediumConfirmedSuppress error message on successful exit of vncviewerpatch
3982problem with maximize on xemacsxemacs21MediumIn Progressfix-maximization-bug.diffdiff
3982problem with maximize on xemacsxemacs21MediumIn Progressoriginal patch to XEmacs dev version to fix maximization bugdiff
2913mod_auth_pam fallthrough always fails (because mod_auth_pam never returns PAM_USER_UNKNOWN)libapache-mod-auth-pamMediumConfirmedWorkaround patch22-mod-auth-pam-fallthrough-fix